DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and b3glcta

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio


Alignment Length:239 Identity:67/239 - (28%)
Similarity:95/239 - (39%) Gaps:44/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GASQLATEEELALWLHNETRVLC----------------------MVLTLPKNHQSRVRRVKGTW 85
            |..:|.|..|     ||:....|                      .|.|..|.|..||..||.||
Zfish   233 GVPELCTLAE-----HNKRAQSCATTVSSHSPLCGEPVKIENIFVAVKTCKKFHSDRVPVVKKTW 292

  Fly    86 GRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIM 150
            |::.:.|.:.|...|..:..|::|||........|....|.....:|....||.|..||||.:.:
Zfish   293 GKQASLLEYYSDYADPSIPTINLGVPNTERGHCGKTFAILRRFLSSHVPRTDWLLIVDDDTLISL 357

  Fly   151 ENLRFLLYPYDPEAALYFGHRFRTTFPQG---YMSGGAGYVMSRDALRRLNLFAFNNSQFCPINN 212
            ..|:.||..|:....|..|.|:.....||   |::||.|.:.||:|:.:|.....|    |..|:
Zfish   358 PRLQALLSCYESSEPLCLGERYGYGLGQGGYSYITGGGGMLFSREAVVQLLSSGCN----CYSND 418

  Fly   213 NSEDRQIGFCLQNVGVVAGDS------RDEEGRDRFL----PLS 246
            ..:|..:|.||.::.|....|      |.|:....||    |:|
Zfish   419 APDDMVLGMCLNSLRVPVTHSPLFHQARPEDYARDFLSHQTPIS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 52/161 (32%)
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.