DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and b3glct

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031751983.1 Gene:b3glct / 780006 XenbaseID:XB-GENE-951583 Length:518 Species:Xenopus tropicalis


Alignment Length:353 Identity:90/353 - (25%)
Similarity:135/353 - (38%) Gaps:99/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGIQLTDFLEYFQLTD-SQFASTSITQLEEGASQLATEEELALWLHNETRVLC-----------M 66
            |.:.:...|:..:||. .||.|      |:..|..|.|...|.   |....:|           .
 Frog   239 IALYIWKKLDGQELTHVKQFCS------EDPTSSKAAECATAF---NSALPVCGSPVQKEDMFVA 294

  Fly    67 VLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE-DRNN---LYLKMRKALE- 126
            :.|..|.|:.||..||.||.::.....:.|...|..:...|:.:|. :|.:   .:..:.:.:| 
 Frog   295 IKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRIPNVERGHCGKTFAILERFMEL 359

  Fly   127 YVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQG---YMSGGAGYV 188
            ||.|     ..|.:..||||.:.:..|:.||..|:|..|::.|.|:......|   |::||.|.|
 Frog   360 YVGR-----MSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGERYGYGLQAGGYNYITGGGGMV 419

  Fly   189 MSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPT 253
            .||:|:|||    .|:...|..|:..:|..:|.|..::|:....|                  |.
 Frog   420 FSREAVRRL----MNSKCRCYSNDAPDDMVLGMCFSSLGITVTHS------------------PL 462

  Fly   254 F----PTDNWLPKLTFYEPVNETGSTSGISFH-YVKIHEFEMYEYLLYRLHIFGTPLSQRTLPPR 313
            |    |||.....|....|         |||| :..|...::|    |:.               
 Frog   463 FHQARPTDYAKDYLAHQIP---------ISFHKHWNIDPIKVY----YKW--------------- 499

  Fly   314 LGPDELQNQLNQWAQENSTNSNAWLKQE 341
            ||.||   :..|..|:|       ||||
 Frog   500 LGQDE---EKQQHGQKN-------LKQE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 49/166 (30%)
b3glctXP_031751983.1 Fringe 286..489 CDD:367085 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.