DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and LOC564281

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_692721.4 Gene:LOC564281 / 564281 -ID:- Length:341 Species:Danio rerio


Alignment Length:336 Identity:117/336 - (34%)
Similarity:175/336 - (52%) Gaps:36/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLHNETRVLCMVLTL 70
            |.|..|:::|......|.|.::.........|......:.....:.:|...|:...||||.::|.
Zfish    22 LLLFCGILLGFVFVQQLVYLRIEGRTLTPAHILSSHAKSHAWNKKADLVQSLYPRVRVLCWIMTR 86

  Fly    71 PKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGED 135
            |:|.|.|::.|..||.:.||.::::|||.. :...:.:.|.|.|:.||.|..:|.:::.::|.:.
Zfish    87 PENLQKRLQHVNATWAQHCNLVLYMSSQSS-DFPTVGLNVSEGRSQLYWKTIRAFQHIQKHHLQH 150

  Fly   136 YDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRDALRRLNLF 200
            .||||||||||||::||||:||..:|.|..|||||:||....|||||||||||:||:||||. :.
Zfish   151 ADWFLKADDDTFVVLENLRYLLSQHDTEKPLYFGHKFRPFVRQGYMSGGAGYVLSREALRRF-VQ 214

  Fly   201 AFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPTFPTDNWLPK--- 262
            .|...: |...::.||..:|.|::.:||.|.|:||...|:.|.|.        :|..:.:.|   
Zfish   215 GFVTGR-CTHFSSLEDMALGRCMEIMGVKAVDTRDANLRETFNPF--------WPDKHLIHKDNT 270

  Fly   263 ------LTFYE----PVNETGSTSGISFHYVKIHEFEMYEYLLYRLHIFGTPLSQRTLPPRLGPD 317
                  .::|:    |  |..|...|||||::..:..|.||..|.|..||...       |..|.
Zfish   271 KKQDSLYSYYKTKLGP--ECCSDFVISFHYLRAADMYMLEYYTYHLRPFGYKY-------RFNPH 326

  Fly   318 ELQN---QLNQ 325
            ..||   ::||
Zfish   327 HHQNNTIEINQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 71/158 (45%)
LOC564281XP_692721.4 Galactosyl_T <153..>244 CDD:304462 51/92 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.