DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and b3glctb

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001289177.1 Gene:b3glctb / 564156 ZFINID:ZDB-GENE-091204-128 Length:493 Species:Danio rerio


Alignment Length:268 Identity:67/268 - (25%)
Similarity:97/268 - (36%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEG-ASQLATEEELALWLHNETRVLC-----------------------MVLTLPKNHQSRVRRV 81
            ||| ...|....|....||..:...|                       .|.|..:.|:.||..|
Zfish   221 EEGRGPTLTAVNEFCSELHGSSSAKCCATAVNTYLSACGKPVLKEDVFVAVKTCQRFHRDRVPIV 285

  Fly    82 KGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDT 146
            |.||.:....|.:.|...|..:..:.:|||........|....|............|.|..||||
Zfish   286 KQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRRFASGAVTQAPWLLIVDDDT 350

  Fly   147 FVIMENLRFLLYPYDPEAALYFGHRFRTTFPQ---GYMSGGAGYVMSRDALRRLNLFAFNNSQFC 208
            .:.:..||.||..|||..|:..|.|:.....:   .|::||.|.|.||.|::  |:.|...|  |
Zfish   351 LISLPRLRRLLSCYDPTEAVSVGERYGYGLSRDGYSYITGGGGMVFSRVAVQ--NILAGGCS--C 411

  Fly   209 PINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPTFPTDNWLPKLTFYEPVNETG 273
            ..::..:|..:|.||..:|               ||::...:......|:::.:|        ..
Zfish   412 RSSDAPDDMVLGMCLTTLG---------------LPVTHSPLFHQARPDDYVKEL--------LA 453

  Fly   274 STSGISFH 281
            ..|.||||
Zfish   454 RQSPISFH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 49/161 (30%)
b3glctbNP_001289177.1 Galactosyl_T <121..>193 CDD:304462
Galactosyl_T 264..465 CDD:304462 59/225 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.