DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 / 448225 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis


Alignment Length:272 Identity:82/272 - (30%)
Similarity:131/272 - (48%) Gaps:30/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEGASQLATEEELALWLHNETRVLCMVLTLPK--NHQSRVRRVKGTWGRRCNKLIFISSQEDREL 103
            :|...:|:..|.|.  |.:..:|.|::|..||  :|.:.||.   ||.:.|:|..:.||:..:..
 Frog    48 KEEVKKLSESERLE--LSHSMQVYCIILVRPKDLSHWAAVRE---TWSKHCDKADYYSSEPMKVF 107

  Fly   104 GVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYF 168
            ..|.|    |.|:|:..||||::..|.|:...|:||......||.::|||::.|...||....|.
 Frog   108 ESISV----DTNDLWAMMRKAIQMTYENNKNAYNWFFICTPSTFAVIENLKYFLLQKDPSQPYYL 168

  Fly   169 GHRFRTTFPQG---YMSGGAGYVMSRDALRRLNLFAFNNSQFCP-----INNNSEDRQIGFCLQN 225
            ||    |...|   |:....|.|:|.::|.|| ...|...:.||     |...|||:|:..||:.
 Frog   169 GH----TVKSGDLDYVDIAGGIVLSIESLHRL-FSIFKEPEKCPEQGGLIFKMSEDKQLAMCLKY 228

  Fly   226 VGVVAGDSRDEEGRDRFLPLSLKFMLPTFPTDNWLPKLTFYEPVNETGSTSGISFHYVKIHEFEM 290
            .||:|.::.|.||::.|...|:..::.....:|  |:    :.|....|...|:|..:..:...:
 Frog   229 KGVLAENAEDSEGKNVFNTKSVGTLIQETMANN--PQ----KVVEGCCSDMAITFSGISPNFMHV 287

  Fly   291 YEYLLYRLHIFG 302
            ..|.:|||..:|
 Frog   288 MMYGVYRLRAYG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 56/168 (33%)
c1galt1c1NP_001004886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.