DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and LFNG

DIOPT Version :10

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001035257.1 Gene:LFNG / 3955 HGNCID:6560 Length:379 Species:Homo sapiens


Alignment Length:198 Identity:51/198 - (25%)
Similarity:81/198 - (40%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFI-SSQEDRELG-------VIDVGVPEDRNNLYL 119
            |...|.|..|.|::|:..:..||..|..::.|| :..||..|.       :.:......|..|..
Human   115 VFIAVKTTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAHSRQALSC 179

  Fly   120 KMRKALEY-VYRNHGEDYDWFLKADDDTFVIMENLRFLL-----YPYDPEAALYFG--------- 169
            ||  |:|| .:...|.  .||...|||.:|   |||.||     ||:..:  :|.|         
Human   180 KM--AVEYDRFIESGR--KWFCHVDDDNYV---NLRALLRLLASYPHTRD--VYVGKPSLDRPIQ 235

  Fly   170 -------HRFRTTFPQGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSE------DRQIGF 221
                   ::.|... ..:.:||||:.:||....:::.:| :...|.   |.:|      |..||:
Human   236 AMERVSENKVRPVH-FWFATGGAGFCISRGLALKMSPWA-SGGHFM---NTAERIRLPDDCTIGY 295

  Fly   222 CLQ 224
            .::
Human   296 IVE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:473923 50/194 (26%)
LFNGNP_001035257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..107
Fringe 110..358 CDD:367085 51/198 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.