DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and CG34057

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster


Alignment Length:339 Identity:168/339 - (49%)
Similarity:236/339 - (69%) Gaps:8/339 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRNILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGA---SQLATEEELALWLHNETR 62
            |.|||:.||||:::||:||||:.|.:|    :.:..:...|:.|   ..:|:||.||.||..|.|
  Fly    21 MIRNIIFLVLGIMLGIRLTDFIGYLKL----WRNNDLRASEKAALLKYPVASEEHLATWLRREVR 81

  Fly    63 VLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPEDRNNLYLKMRKALEY 127
            :||:|||:|.:|.::...|..|||.|||||||:|||.|..|.::.:...|.|.|||.|:|..:.|
  Fly    82 ILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAY 146

  Fly   128 VYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRD 192
            |::::..:|||||||||||:::|||||..|||||||:::|||.||:..|.|||||||.|||:|||
  Fly   147 VHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRD 211

  Fly   193 ALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLPLSLKFMLPTFPTD 257
            |||||||||.|::..|.:|..|||.|||.|||:|||:|||:||.:|..||||::...:.||..::
  Fly   212 ALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSN 276

  Fly   258 NWLPKLTFYEP-VNETGSTSGISFHYVKIHEFEMYEYLLYRLHIFGTPLSQRTLPPRLGPDELQN 321
            :||....|::| .::..:.|.|||||||..|||::|:.||.:.:||...:.|.||.|||..::..
  Fly   277 SWLEGYFFHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHRTPRALPSRLGFRQMNE 341

  Fly   322 QLNQWAQENSTNSN 335
            :|..|:|:.:.|.|
  Fly   342 RLQHWSQQVTDNKN 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 93/158 (59%)
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 87/149 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.