DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and B3glct

DIOPT Version :10

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:174 Identity:52/174 - (29%)
Similarity:83/174 - (47%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE-DRNN---LYLKMRK 123
            :...|.|..|.|..|:..||.||..:.:.:.:.|...:..:..:|:|:|. ||.:   .:..:.|
Mouse   353 IFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEK 417

  Fly   124 ALEYVYRNHGED-YDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQG---YMSGG 184
            .|     ||..: ..|.:..||||.:.:..||.||..||....::.|.|:......|   |::||
Mouse   418 FL-----NHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGG 477

  Fly   185 AGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGV 228
            .|.|.||:|:|||.:    :|..|..|:..:|..:|.|...:||
Mouse   478 GGMVFSREAIRRLLV----SSCRCYSNDAPDDMVLGMCFSGLGV 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:473923 50/166 (30%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:473923 52/174 (30%)

Return to query results.
Submit another query.