DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and B3glct

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:174 Identity:52/174 - (29%)
Similarity:83/174 - (47%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE-DRNN---LYLKMRK 123
            :...|.|..|.|..|:..||.||..:.:.:.:.|...:..:..:|:|:|. ||.:   .:..:.|
Mouse   353 IFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEK 417

  Fly   124 ALEYVYRNHGED-YDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQG---YMSGG 184
            .|     ||..: ..|.:..||||.:.:..||.||..||....::.|.|:......|   |::||
Mouse   418 FL-----NHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGG 477

  Fly   185 AGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGV 228
            .|.|.||:|:|||.:    :|..|..|:..:|..:|.|...:||
Mouse   478 GGMVFSREAIRRLLV----SSCRCYSNDAPDDMVLGMCFSGLGV 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 50/166 (30%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:389837 52/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.