DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and CG8708

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster


Alignment Length:343 Identity:132/343 - (38%)
Similarity:191/343 - (55%) Gaps:42/343 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNILCLVLGLIIGIQLTDFLEYF------------QLTDSQFASTSITQLEEGASQLATEE---- 51
            |::..|:.||::|..|.......            :.:|||.|:         ..|||.|:    
  Fly    21 RSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVAT---------GGQLAPEQSGLK 76

  Fly    52 --------ELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDV 108
                    .:|..|..|.|:||.|:|.|.||:.:.|.||.|||:|||.|:|:||..|.||..:.:
  Fly    77 HDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKL 141

  Fly   109 GVPEDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFR 173
            .|.|.|.||:.|:::|.:|||.:|..|.|:|.||||||:.::||:|::||||:||..::||.:|:
  Fly   142 DVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFK 206

  Fly   174 TTFPQGYMSGGAGYVMSRDALRRLNLFAFNNSQFC-PINNNSEDRQIGFCLQNVGVVAGDSRDEE 237
            ....||||||||||::||:||||..:....|.:.| |....:||.:||.|::|:.|.|||||||.
  Fly   207 PFVKQGYMSGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEI 271

  Fly   238 GRDRFLP-LSLKFMLPTFPTDN-WLPKLTFYEPVNETG----STSGISFHYVKIHEFEMYEYLLY 296
            ||.|..| :....::|.....| |.....:|:  .:.|    |...||||||..:.|.:.:||:|
  Fly   272 GRGRMFPFIPEHHLIPAKADKNFWYWNYLYYK--TDDGLDCCSDLAISFHYVAPNSFYVLDYLIY 334

  Fly   297 RLHIFGTPLSQRTLPPRL 314
            .|..:|...|...||.:|
  Fly   335 HLKPYGLLRSLEPLPAKL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 77/159 (48%)
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.