DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and C1GalTA

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster


Alignment Length:359 Identity:147/359 - (40%)
Similarity:211/359 - (58%) Gaps:30/359 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNILCLVLGLIIGIQLTDFLEYFQLTDSQF-------------ASTSITQLE--------EGASQ 46
            |:.:.|::|||:|..|.:...|.....|:|             |..|...:|        .|...
  Fly    20 RSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQDVGGHEH 84

  Fly    47 LATEEELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVP 111
            :.....:|..|::|.||||.::|.|.|||.:.|.||.|||:|||||||:||.:|.||..:.:.|.
  Fly    85 VHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDELDAVALPVG 149

  Fly   112 EDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTF 176
            |.||||:.|.::|.:|:|.:|..|.||||||||||:.|:||:|::||||.||..:|||.:|:...
  Fly   150 EGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYV 214

  Fly   177 PQGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNN-SEDRQIGFCLQNVGVVAGDSRDEEGRD 240
            .|||||||||||:||:|:||..:.|..|.:.|..:|: :||.:||.|||||.|:||||||..||.
  Fly   215 KQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRDSNGRG 279

  Fly   241 RFLPLSLKFMLPTFPTDN--WLPKLTFYEPVNETG----STSGISFHYVKIHEFEMYEYLLYRLH 299
            ||.|...:..|....||.  |..:..||:  .:.|    |.:.||||||..::..:.:||:|.|.
  Fly   280 RFFPFVPEHHLIPSHTDKKFWYWQYIFYK--TDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLR 342

  Fly   300 IFGTPLSQRTLPPRLGPDELQNQLNQWAQENSTN 333
            .:|...:...||.:|...||..::.:.|.|::::
  Fly   343 PYGIINTPDALPNKLAVGELMPEIKEQATESTSD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 86/159 (54%)
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 80/145 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.