DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and CG3119

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster


Alignment Length:350 Identity:123/350 - (35%)
Similarity:185/350 - (52%) Gaps:35/350 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLHNETRVLCMV 67
            |:.|.|:.|.:.|     |:..|.|....:..:.:|......|.:.|.....:......|:||||
  Fly     8 RSQLHLLTGFMAG-----FVLAFVLLLYVYDVSRVTPCWSSTSTMTTATTARIEDGPPPRILCMV 67

  Fly    68 LTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVP-----EDRNNLYLKMRKALEY 127
            ||.|:|.||..|.|..|||:||::|||.||::...|||:.|..|     ||   |:.|.|:...:
  Fly    68 LTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEPTGGGYED---LWNKTREGFRH 129

  Fly   128 VYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRD 192
            |:.::..||||||||||||:|:||||:.||..:||...::||::. :.:...||||||.|::||:
  Fly   130 VWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKM-SRYNVSYMSGGASYILSRE 193

  Fly   193 ALRRLNLFAFNNSQFCPINNNS--EDRQIGFCLQNVGVVAGDSR---DEEGRDRFLPLSLKFMLP 252
            ||.|....|:.:...||.....  ||..:|.|:|||||...||.   |.:.:.:|:||.|:..:.
  Fly   194 ALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMS 258

  Fly   253 ----TFPTDNWLPKLTFYEPVNETG----STSGISFHYVKIHEFEMYEYLLYRLHIFG-TPLSQR 308
                |.|  .||..::....  |||    |...::|||.......:||:|:|.|.:|. ..:|:|
  Fly   259 DANYTIP--EWLRLMSLSRV--ETGLACCSNYSVAFHYASRERMFLYEFLIYHLKVFDPNQISER 319

  Fly   309 TLPPRLGPDELQNQLNQWAQENSTN 333
            ....||   .|.:...::..|:::|
  Fly   320 GHRSRL---TLSDLTRRFPLEDNSN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 73/165 (44%)
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 66/152 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447016
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.