DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and tgy

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285425.1 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster


Alignment Length:347 Identity:122/347 - (35%)
Similarity:188/347 - (54%) Gaps:39/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRN-----------ILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQL------A 48
            |||:           ::.||...:||:        |...|....:.....|..|.|.:      .
  Fly    28 MYRSAQRISTDRLVLLILLVSTTVIGL--------FAYWDVMVLNAGALPLSRGTSSVDYMEPGL 84

  Fly    49 TEEELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPED 113
            ..|.||..:|.|.||||.|||.||.|::|...|..|||:||||:.|::|:.|.||..:.:..|:.
  Fly    85 RNETLAEKMHREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDELPTVVLTKPDR 149

  Fly   114 RNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFP- 177
            ...|:.|.::|..:::.....:.|||:||||||::.:||||::||||.||..:|||..::.... 
  Fly   150 YEMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFGFNYKMVGTH 214

  Fly   178 ---QGYMSGGAGYVMSRDALRRLNLFA--FNNSQFC-PINNNSEDRQIGFCLQNVGVVAGDSRDE 236
               :.|||||:|||:||:|||   :||  .|::..| ..::::||.::|.||.|:||.|||||||
  Fly   215 QKNESYMSGGSGYVLSREALR---IFAEGVNDTTKCRQEDDHAEDVEMGKCLFNLGVKAGDSRDE 276

  Fly   237 EGRDRFLPLSL--KFMLPTFPTDNWLPKLTFYEPVN--ETGSTSGISFHYVKIHEFEMYEYLLYR 297
            :.|:||.|::.  ..:......|.||.|..:|.|.:  :..|...::||||...:..:|:|..|:
  Fly   277 QLRNRFYPIAPYGALLSGNVGMDFWLYKYAYYNPRSCMDCLSEYPVAFHYVHSKQLYVYDYFNYQ 341

  Fly   298 LHIFGTPLSQRTLPPRLGPDEL 319
            ..:.|.......||.::..:||
  Fly   342 FQLSGRAQVAERLPKKIREEEL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 68/165 (41%)
tgyNP_001285425.1 Galactosyl_T 103..>270 CDD:304462 71/169 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458861
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47757
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.