DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:285 Identity:88/285 - (30%)
Similarity:137/285 - (48%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LATEEELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVP 111
            |...|:..:.|....||.|::|..||: .|....||.||.:.|:|..|.||:..:....|::   
Human    53 LKISEDERMELSKSFRVYCIILVKPKD-VSLWAAVKETWTKHCDKAEFFSSENVKVFESINM--- 113

  Fly   112 EDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTF 176
             |.|:::|.||||.:|.:..:.:.|:||..|...||.|:|||::.|...||....|.||    |.
Human   114 -DTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGH----TI 173

  Fly   177 PQG---YMSGGAGYVMSRDALRRLNLFAFNNSQFCP-----INNNSEDRQIGFCLQNVGVVAGDS 233
            ..|   |:....|.|:|.::::|||.. .|..:.||     |...|||:|:..||:..||.|.::
Human   174 KSGDLEYVGMEGGIVLSVESMKRLNSL-LNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENA 237

  Fly   234 RDEEGRDRF----LPLSLKFMLPTFPTDNWLPKLTFYEPVNETGSTSGISFHYVKIHEFEMYEYL 294
            .|.:|:|.|    :.||:|..:...|.          :.|....|...::|:.:..::..:..|.
Human   238 EDADGKDVFNTKSVGLSIKEAMTYHPN----------QVVEGCCSDMAVTFNGLTPNQMHVMMYG 292

  Fly   295 LYRLHIFGTPLSQRT--LPPRLGPD 317
            :|||..||...:...  |||. |.|
Human   293 VYRLRAFGHIFNDALVFLPPN-GSD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 57/166 (34%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.