DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and F37A4.3

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_498472.2 Gene:F37A4.3 / 185403 WormBaseID:WBGene00018133 Length:272 Species:Caenorhabditis elegans


Alignment Length:219 Identity:41/219 - (18%)
Similarity:71/219 - (32%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKL--IFISSQEDRELGVIDVGVPEDRNNLYLK 120
            ||.:    :.|||...........|.:|   |:|:  .|:              ||..    |:.
 Worm    41 HNTS----LFLTLQSTGPEMTNLCKKSW---CDKVDDYFV--------------VPHH----YVN 80

  Fly   121 MRKALEYVYRNH-----------GEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRT 174
            .:|..|....:|           .:...|::.|.|:.:..:|.|...|..:|....:|       
 Worm    81 WQKPTEQWLIHHFSKMILHTRRLPQQAQWYMFAFDNNYFFVERLIKELSKFDSHLPIY------- 138

  Fly   175 TFPQGY---MSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDE 236
            |..:.:   :......:.||.|   ||.|.....:.|..|..:.:..:..|:....:..  |.|.
 Worm   139 TILRDFHADIQHKPVLIFSRSA---LNTFYDLEEENCSENAENVEEWLTTCMSIPPITI--SVDR 198

  Fly   237 EGRDRFLPLSLKFM---LPTFPTD 257
            ..:.|...:...|.   :.|.|.|
 Worm   199 SKKSRIFAIKRHFQVDEMKTMPND 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 32/174 (18%)
F37A4.3NP_498472.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.