DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and C17A2.3

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:187 Identity:64/187 - (34%)
Similarity:102/187 - (54%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQE----DRELGVIDVGVPEDRNNLYLKMR 122
            ::.|.|.|..|.::.||..|..||..||:...|.:...    |.....:...:.:..::|:.|..
 Worm   101 QIFCFVETSTKYYKDRVPSVASTWLPRCDHGRFFTKTHLPYPDIAYSTVYRNLRDTYDDLFRKSI 165

  Fly   123 KALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGY 187
            .:|.|.|.:..:.:||:||.||||||.|::||..|...:|...||.|:|.......||.|||:||
 Worm   166 FSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYLGYRLAPFMNNGYNSGGSGY 230

  Fly   188 VMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDSRDEEGRDRFLP 244
            ::|..|:|......::|.:.||. :..|||.:|.||::||:...|:||::..:||:|
 Worm   231 ILSNAAMRMFVEQLYHNVRLCPY-DRGEDRGMGRCLESVGITPSDTRDDQELNRFMP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 55/162 (34%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.