DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and C02H6.1

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 / 182129 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans


Alignment Length:339 Identity:93/339 - (27%)
Similarity:149/339 - (43%) Gaps:60/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYRNILCLVLGLIIGIQLTDFL-----------------EYFQLTDSQFASTSITQLEEGASQLA 48
            :|..:|...|.||:.....:||                 ||:.||      .::.:|.:|..   
 Worm    18 LYTLLLTFSLSLIVFPLYRNFLIPADLYTHFPAIIHPYREYYSLT------RNVNKLTQGIE--- 73

  Fly    49 TEEELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRC-NKLIFISSQEDRELGVIDVGVP- 111
             :.|....|....::.|.|.|..|....||..:..||..|| |...|:.:.      ::|..:| 
 Worm    74 -DSEATYDLPTSGQLFCFVETSKKYFNDRVPSMASTWLPRCDNGRFFLKTP------LVDEKIPF 131

  Fly   112 -------EDR-NNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYF 168
                   ||. .:|:.|...:..|.|....:|:||:||||||.:.::::|:..|...|....|:.
 Worm   132 STVYRNLEDSYYDLFRKTLLSFYYSYTYISKDFDWYLKADDDNYFMIDHLKEYLDTLDASKPLFL 196

  Fly   169 GHRFRTTFPQGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGVVAGDS 233
            |:|.:.....||.||||||::|..|:|......:::.:.||. :.:|||.|..||.::|::..|:
 Worm   197 GYRMKPFLEGGYNSGGAGYLLSNAAVRIFVEHLYHDEKRCPY-DWAEDRGIARCLASMGILPSDT 260

  Fly   234 RDEEGRDRFLPLSLKFMLPTFPTDNWLPKLTFYEPVNETG--STSGISFHYVKIHEFEMYEYLLY 296
            ||.:|..||||    |.....|   .:|:...|.|:....  |...||.|.:...:....:.:||
 Worm   261 RDNDGSCRFLP----FRPSEMP---GIPEAYHYYPLKNGSFVSEKFISLHRISPRKMIFLDSILY 318

  Fly   297 RLHIFGTPLSQRTL 310
                   |.|:|.|
 Worm   319 -------PSSERRL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 53/168 (32%)
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 45/145 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.