DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and ZC250.2

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 / 178968 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans


Alignment Length:323 Identity:73/323 - (22%)
Similarity:125/323 - (38%) Gaps:65/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLH----------------- 58
            |.|:...:.:.:....:.| :::..:|....|.|..|...|.|.|..|                 
 Worm   148 GFILSKSVVEIIRKVDIND-RWSGFAIDAKYEFAQFLHKWENLRLHHHPDYFCCGDTIDSCIVKC 211

  Fly    59 -----------NETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDRELGVIDVGVPE 112
                       :::.|..||.|...:|.:|:..:|.||....:::.:.|.:||..:..|::||..
 Worm   212 SIPFPKTSNSISDSEVHVMVKTFEGHHVNRLEVLKNTWASDVSRIEYCSDKEDPAIPTINLGVDN 276

  Fly   113 -DRNNLYLKMRKALEYVYR---NHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFR 173
             ||.:    ..|..|...|   :.|....|.:.|||||.:..:.|:.:|..||....:..|.|:.
 Worm   277 TDRGH----CAKTWEIFRRFLGSSGNGAKWLVVADDDTLMNFKRLKQMLELYDSGDKIIIGERYG 337

  Fly   174 TTFP------QGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINNNSEDRQIGFCLQNVGV-VAG 231
            ..|.      ..|.:||:|.:.:|.|:..|    ......|..|.:.:|..||.|....|: :..
 Worm   338 YGFSLNGDSGYDYPTGGSGMIFTRSAVESL----LAQCPSCIANTDPDDMTIGICALTAGIPIVH 398

  Fly   232 DSRDEEGRD-RFLPLSLKFMLPTFPTDNWLPKLTFYEPVNETGSTSGISFHYVKIHEFEMYEY 293
            :||..:.|. .:.|..:|:.:.       ..|.|..:|         ||.:|..:.|.|.|.:
 Worm   399 ESRLHQARPLDYAPEYIKYPIS-------FHKFTDIDP---------ISVYYEYLVELEEYNH 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 45/168 (27%)
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 51/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.