DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and Y38C1AB.5

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_499851.3 Gene:Y38C1AB.5 / 176819 WormBaseID:WBGene00021407 Length:261 Species:Caenorhabditis elegans


Alignment Length:258 Identity:76/258 - (29%)
Similarity:134/258 - (51%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNK-LIFISSQEDRELGVIDVGVPEDRN 115
            :::|.|.....:||::.|...:|::|.:.:..||.:.|:. |.|..|:.:..:..|...:...|:
 Worm    11 QISLILGAPQTILCLIHTATPSHETRAKTILETWVQHCDDFLFFTDSKMNDSIPHIYYPLLNSRD 75

  Fly   116 NLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGY 180
            :.:.|:|:..:||.....:.|||:.:|||||:.:|.|:|.||..|.|....|.|.::....|:|:
 Worm    76 HSWEKIRRVFKYVRDKITKKYDWYYRADDDTYALMHNMRTLLDNYSPTKHHYLGLQWNFFTPRGF 140

  Fly   181 MSGGAGYVMSRDALRRLNLFAFNNSQF----CPINNNS-EDRQIGFCLQNVGVVAGDSRDEEGRD 240
             :.|:.|::||..:.     |||....    ||.::.: ||:::..||.::.:...|.|||.|.:
 Worm   141 -NDGSSYILSRPTME-----AFNEVMLDPDRCPDHHRAEEDQELAKCLAHMEIYPEDIRDEMGSE 199

  Fly   241 R---FLPLSLKFMLPTFPTDNWLPKLTFYEPVNETGSTSG--ISFHYVKIHEFEMYEYLLYRL 298
            |   |.||...    |...|.:..:|.:|..:.|..:.|.  ||||:|..:|..:.:|:.|||
 Worm   200 RIQHFHPLEQL----TIYKDTFNRRLAYYPAMKEDENFSDKMISFHHVSPYEMRLMDYIFYRL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 47/164 (29%)
Y38C1AB.5NP_499851.3 Galactosyl_T 33..>129 CDD:304462 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.