DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34056 and C38H2.2

DIOPT Version :9

Sequence 1:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_499293.2 Gene:C38H2.2 / 176455 WormBaseID:WBGene00008019 Length:389 Species:Caenorhabditis elegans


Alignment Length:283 Identity:120/283 - (42%)
Similarity:172/283 - (60%) Gaps:23/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QFASTSITQLEEGASQLATEEELALWLHNETRVLCMVLTLPKNHQSRVRRVKGTWGRRCNKLIFI 95
            ||.|.:.:...:|.|.:|.|      :..:.||.|.:||..:||..|.:.||.||.:||||.:|:
 Worm    80 QFHSNNSSHSHDGESLIADE------VAKKVRVFCWILTGKQNHDKRAKHVKATWAKRCNKYVFM 138

  Fly    96 SSQEDRELGVIDVGVPEDRNNLYLKMRKALEYVYRNHGEDYDWFLKADDDTFVIMENLRFLLYPY 160
            ||:||.||..|::.|.|.|:.|:.|.:.|.:|:|.:|..||||||||||||:|:||||||:|..:
 Worm   139 SSEEDAELPAINLNVSEGRDYLWAKTKGAFKYIYDHHLNDYDWFLKADDDTYVVMENLRFMLLAH 203

  Fly   161 DPEAALYFGHRFRTTFPQGYMSGGAGYVMSRDALRRLNLFAFNNSQFCPINN-NSEDRQIGFCLQ 224
            .|:..::||.:|:.....||.|||||||:||:||::....|..:...|..|: .:||.::|.||:
 Worm   204 SPDEPIHFGCKFKPFTQGGYHSGGAGYVLSREALKKFIEVALPDKSLCSQNHGGAEDAEMGKCLE 268

  Fly   225 NVGVVAGDSRDEEGRDRFLP------LSLKFMLPTFPTDNWLPKLTFYEPVNETGSTS----GIS 279
            .|||.||||||.:|..||:|      ||...:.|.|    |..:.|:| |::: |.|.    .:|
 Worm   269 KVGVKAGDSRDADGHHRFMPFVPEHHLSPGHVDPKF----WFWQYTYY-PMDQ-GPTCCSDYAVS 327

  Fly   280 FHYVKIHEFEMYEYLLYRLHIFG 302
            ||||..:...:.|||:|.|..||
 Worm   328 FHYVNPNLMYVLEYLIYHLKPFG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 75/159 (47%)
C38H2.2NP_499293.2 Galactosyl_T 106..>274 CDD:304462 80/167 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.