DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13907 and MCH4

DIOPT Version :9

Sequence 1:NP_001286894.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_014522.1 Gene:MCH4 / 854030 SGDID:S000005479 Length:501 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:57/226 - (25%)
Similarity:98/226 - (43%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DDDEESVYGELPPPPDGGY-GWVICFASFMCNMIVDGIAYTFGIF-----LEEFVAYFHE----G 112
            |||.|.        ||||. .|::.|.:||      |:...||:.     :|.:::. |:    .
Yeast    84 DDDREF--------PDGGLKAWLVVFGAFM------GLVPVFGLINSLGAIESYISK-HQLANIS 133

  Fly   113 KGTVAWVGSLLSGVYLSAGPIVSALANKYGCR-----AVCIAGSIIACIAFVLSTFSTNVSMLMA 172
            ..|::|:.||    ||:...:...|:..|..|     .:|....|.|...|.|:...:....::|
Yeast   134 SSTISWIFSL----YLAISFLSCILSGGYFDRNGSIGLMCTGTVIYAGGLFALANCKSVWQFILA 194

  Fly   173 TYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALL 237
             :....|.|.|::..|.:..|..:|..:|.:||.|:..|...|...|..:...|.:|.|::.|:.
Yeast   195 -FSVCSGLGTGILMTPLIGTVATWFLKRRGIATSISTMGGSIGGIVFPIMLRKLYKEVGFQWAIR 258

  Fly   238 IFAGLILNCAIFGAMM-----RPLTYPKKKK 263
            |.:.:.|.|.|..:::     :|:..|.|.|
Yeast   259 ILSFICLTCLICASVLARERTKPVVQPFKSK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13907NP_001286894.1 MFS 78..>258 CDD:119392 46/198 (23%)
MFS <570..748 CDD:119392
MCH4NP_014522.1 MFS_MCT_SLC16 96..490 CDD:340910 49/206 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343232
Domainoid 1 1.000 72 1.000 Domainoid score I2205
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4139
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.