DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13907 and AT1G80530

DIOPT Version :10

Sequence 1:NP_612069.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_178168.1 Gene:AT1G80530 / 844392 AraportID:AT1G80530 Length:561 Species:Arabidopsis thaliana


Alignment Length:188 Identity:40/188 - (21%)
Similarity:70/188 - (37%) Gaps:36/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 FVYLVDAAKEHDIPKN-----------DAAMLLSIIGITNTVGRVFCGWVAD-------LPQVNS 636
            |||.:.......:..|           |..:||.:....|.:||:..|.:::       ||:.  
plant   352 FVYFLGMGSGVTVSNNLAQIGFAFGIKDTTILLCLFSFFNFIGRLASGAISEHFVRSRTLPRT-- 414

  Fly   637 LLLNNCCLLVSTIAVTLTPLCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLL 701
             |......||......|..:...:..|:..:: .|:.: |:..|:...:.:|.||......|..:
plant   415 -LWMGAAQLVMVFTFLLFAMAIDHTIYVATAL-IGICM-GFQFLSIATISELFGLRHFGINFNFI 476

  Fly   702 ILFRGFAALI-GTPLAGAIYD--------MT----HTYDLPFYMAGALFGISTITSFL 746
            :|.....|.| ...|||.|||        ||    ..:.:.|.:...:.|:.|:.|.:
plant   477 LLGNPLGATIFSAILAGYIYDKEADKQGKMTCIGPDCFRVTFLVLAGVCGLGTLLSII 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13907NP_612069.1 MFS_MCT_SLC16 77..>260 CDD:340910
MFS <566..748 CDD:475125 40/188 (21%)
AT1G80530NP_178168.1 MFS_Mch1p_like 12..529 CDD:340912 38/181 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.