DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13907 and LOC733714

DIOPT Version :9

Sequence 1:NP_001286894.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001037956.1 Gene:LOC733714 / 733714 -ID:- Length:425 Species:Xenopus tropicalis


Alignment Length:154 Identity:38/154 - (24%)
Similarity:70/154 - (45%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMA 172
            |.:|....|..:.::.:.:.|...|||..:.|:.|..|....|:||..::.::..|:.:.:.|..
 Frog    87 YLNEENVLVGLLLAIKALLQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYAFLCV 151

  Fly   173 TYGFMGGFGFGMIYLPAVVAVGYYF--ETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNA 235
            ..| :.|.|.....:||:..:.:.|  :.:|..|.|||:.|...|..|..|..:.:.|..|....
 Frog   152 ARG-LQGIGSSFTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAP 215

  Fly   236 LLIFAGL-ILNCAIFGAMMRPLTY 258
            .|..|.| :|:..:...::||..:
 Frog   216 FLAIAALALLDGVLQLCILRPTRF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13907NP_001286894.1 MFS 78..>258 CDD:119392 38/152 (25%)
MFS <570..748 CDD:119392
LOC733714NP_001037956.1 MFS_1 94..370 CDD:284993 36/147 (24%)
2_A_01_02 96..237 CDD:273318 34/141 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.