DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13907 and AT5G45275

DIOPT Version :10

Sequence 1:NP_612069.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_974886.1 Gene:AT5G45275 / 2746193 AraportID:AT5G45275 Length:570 Species:Arabidopsis thaliana


Alignment Length:261 Identity:58/261 - (22%)
Similarity:85/261 - (32%) Gaps:90/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 VKSVVNTMLDVSLLKDPVFMLIGVSNI------------------FGMAGLYVPFVYLVDAAKEH 600
            :::...|..|.|.....:..::|:|.:                  .|:|.||.|...::      
plant    17 IQAFTGTNFDFSTYSSNLKSVLGISQVQLNYLAVASDLGKVFGWSSGLALLYFPLWTVL------ 75

  Fly   601 DIPKNDAAMLLSIIG-------ITNTVGRVFCGWVADLPQVNSLLLNNCCLLVSTIAVTLTPLCY 658
                 .||.::..:|       |||         |..||.:   |:..||||..........:|:
plant    76 -----FAAAIMGFVGYGVQWLVITN---------VISLPYI---LVFLCCLLAGLSICWFNTVCF 123

  Fly   659 -----------SYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALI- 711
                       |.|..:|:| |.|::.:.|....:.|......|..|.||  |:.||..||||| 
plant   124 VLCIRNFPANRSLALSLTVS-FNGVSAALYTLAYNAINPVSTELYLLLNA--LVPLFVSFAALIP 185

  Fly   712 ---GTPLAGAIYDMTHTYDLPFYM------------------------AGALFGISTITSFLAPC 749
               ..||.....|......|.|.:                        |..|||.|.:...|..|
plant   186 ILRQPPLEPLPPDGVRRDSLMFLLLNILAVLNGVYLLLFRSKTSDVTSARLLFGGSILLLILPLC 250

  Fly   750 L 750
            |
plant   251 L 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13907NP_612069.1 MFS_MCT_SLC16 77..>260 CDD:340910
MFS <566..748 CDD:475125 53/245 (22%)
AT5G45275NP_974886.1 Nodulin-like 7..241 CDD:284279 54/249 (22%)
MFS <355..547 CDD:475125
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.