DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13907 and SLC16A11

DIOPT Version :9

Sequence 1:NP_001286894.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001357478.1 Gene:SLC16A11 / 162515 HGNCID:23093 Length:447 Species:Homo sapiens


Alignment Length:756 Identity:138/756 - (18%)
Similarity:233/756 - (30%) Gaps:330/756 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PPDGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVS 135
            |||||:|||:..|:|..|.:..|:..:.|:...:...:|.......||:.:|...|..:|.|:.|
Human     8 PPDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGS 72

  Fly   136 ALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETK 200
            ||:.::|.|.|.:.|.::|.:.||.|.|::::..|....|.:.|||:.:::.||:..:..||..:
Human    73 ALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAGFGWALVFAPALGTLSRYFSRR 137

  Fly   201 RSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPLTYPKKKKQK 265
            |.||.|:|:.|:|..:...||....||:.:||:.|||:...:.|:....||::.||..|      
Human   138 RVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLVLP------ 196

  Fly   266 PLMQRMYEEKQLQLERGSFAGSHFMVQLPDGTIERKLKMPLNADPGVHSSLNLELLAQQAGGGGL 330
                                                      .||                    
Human   197 ------------------------------------------GDP-------------------- 199

  Fly   331 HPVSTLPTITESKVVDVHRQNGAQSPPNGDSNGQLSARSAAGAVGRRPHRNSESENSPYHSQDAM 395
                                   .:||          ||...|:|                    
Human   200 -----------------------PAPP----------RSPLAALG-------------------- 211

  Fly   396 TRNASQPAFLAGDHQSLPKNGSVPAFNTRVRKTSASERFQPSLAAIRATSRGDLEAGAGGDFASS 460
                                                                             
Human   212 ----------------------------------------------------------------- 211

  Fly   461 KLSLSQRQGGSQTGSSGRMVRPMSRKDIFYSGSVTNLPQYQSQKSLANYRNSVLSLTKYEKSMQS 525
             |||..|:..|                ||..|:.                               
Human   212 -LSLFTRRAFS----------------IFALGTA------------------------------- 228

  Fly   526 VAKLDPLAEAEKHREEYDLCPCLGIPDSVKSVVNTMLDVSLLKDPVFMLIGVSNIFGMAGLYVPF 590
                                                            |:|       .|.:||:
Human   229 ------------------------------------------------LVG-------GGYFVPY 238

  Fly   591 VYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFCGWVAD-----LPQVNSLL--LNNCCLLVST 648
            |:|...|.:..:....||:::::..:.:...|:.|||:||     ||::.::.  |....|.|  
Human   239 VHLAPHALDRGLGGYGAALVVAVAAMGDAGARLVCGWLADQGWVPLPRLLAVFGALTGLGLWV-- 301

  Fly   649 IAVTLTPLCYSYAAY----ITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAA 709
              |.|.|:.....::    :..::.:||:...|..|...:|..|:|:..:..|.||:::......
Human   302 --VGLVPVVGGEESWGGPLLAAAVAYGLSAGSYAPLVFGVLPGLVGVGGVVQATGLVMMLMSLGG 364

  Fly   710 LIGTPLAGAIYDMTHTYDLPFYMAGAL-FGISTITSFLAPCLKRCSPSEETPVHVETLTPIDEEQ 773
            |:|.||:|.:.|.|..:...|.::|:| ...|.|...|...|..|.|:                 
Human   365 LLGPPLSGFLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPA----------------- 412

  Fly   774 GEDAEDDEDQPITIVPKIIKTLASPQQEEGHPQFPQKTSES 814
                    ..|.|..|:..:.|.:||.....|..|..|.::
Human   413 --------SPPATPPPETGELLPAPQAVLLSPGGPGSTLDT 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13907NP_001286894.1 MFS 78..>258 CDD:119392 56/179 (31%)
MFS <570..748 CDD:119392 47/189 (25%)
SLC16A11NP_001357478.1 MFS 14..403 CDD:355786 120/681 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 1 1.000 - - FOG0000033
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.