DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP3

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_006528.2 Gene:USP3 / 9960 HGNCID:12626 Length:520 Species:Homo sapiens


Alignment Length:414 Identity:104/414 - (25%)
Similarity:171/414 - (41%) Gaps:86/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 KTNLASISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLSEVKTPTVNAMMSFM 1163
            |.|.::.::...||.|..|.|::|:|||:|.....|....:.:|   ||  |::........::.
Human   148 KVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELP---AV--ELRNGKTAGRRTYH 207

  Fly  1164 T-----NFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEI-YKLWNDSREEHVEG 1222
            |     |..||....|..|..|.:|||:               ||.|..: |.:|...  .:..|
Human   208 TRSQGDNNVSLVEEFRKTLCALWQGSQT---------------AFSPESLFYVVWKIM--PNFRG 255

  Fly  1223 -RQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQ-------------NGQEPAEPEDGGDVWQ- 1272
             :|:||.||:.|:|:.|:.|:......:.:....|             ||.........|.:.| 
Human   256 YQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQN 320

  Fly  1273 ----MICNNRNKGSVTRQTDFGRTPVSDI-------FRGELRSRLQREGEHSTDVIQPFFTLQLN 1326
                :||     |:.:|:.|    |..|:       ||.: ||:.|..|        |..:|:..
Human   321 EVNCLIC-----GTESRKFD----PFLDLSLDIPSQFRSK-RSKNQENG--------PVCSLRDC 367

  Fly  1327 IEKAASVKEALEILVGRDQLEGVTGSKTKQEVVAWQQMTLEKLPVVLILHLKYFDYRSDGCTKIL 1391
            :.....::|.       |:.|.....|.|::..:.::..::|||.||.||||.|.:.:....|:.
Human   368 LRSFTDLEEL-------DETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYLRNKVD 425

  Fly  1392 KKVDFPVE-LKIDAKILGSKKTSQKQRAYRLFAVVYHDGKEASKGHYITDVFHTGYSSWLRYDDS 1455
            ..|:||:. |.:...:|..:.:..:...|.|.|||.|.|.....|||.....|.|  .|..::||
Human   426 TYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEG--RWFHFNDS 488

  Fly  1456 SVKPVSEKHVLQPHTPRVPYLLYY 1479
            :|....|:.|::...    |:|:|
Human   489 TVTLTDEETVVKAKA----YILFY 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 101/402 (25%)
Peptidase_C19 1223..1480 CDD:239072 71/283 (25%)
USP3NP_006528.2 zf-UBP 29..105 CDD:307999
UCH 159..508 CDD:306860 101/401 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.