DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and UBP3

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_568074.1 Gene:UBP3 / 830150 AraportID:AT4G39910 Length:371 Species:Arabidopsis thaliana


Alignment Length:400 Identity:105/400 - (26%)
Similarity:169/400 - (42%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1111 GLTNRSNYCYINSILQALLGCSPF-YNLLRSIPKQAAVLSEVKTPTVNAMMSFMTNFSSLPSGLR 1174
            |..|..|.||.||:||||..|.|| ..||.......:|        .:|..:.||..:.|.|.: 
plant    24 GFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKSV--------ADAEENLMTCLADLFSQI- 79

  Fly  1175 LRLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLN 1239
                     |..|.|...:..........:..|:::.:          ..:||.|||.|:||::.
plant    80 ---------SSQKKKTGVIAPKRFVQRLKKQNELFRSY----------MHQDAHEFLNYLLNEVV 125

  Fly  1240 DEMLEVIKLIDKPTPQQNGQEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRS 1304
            |.:.:..|.........:...|.:..:|..|.|.      .|.|.::...  |.|.:||:|.|.:
plant   126 DILEKEAKATKTEHETSSSSSPEKIANGLKVPQA------NGVVHKEPIV--TWVHNIFQGILTN 182

  Fly  1305 R---LQREGEHSTDVIQPFFTLQLNIEKAASVKEALEILVGRDQLEGVTGSKTK---------QE 1357
            .   |:.|...:.|  :.|..|.|:||:.:|:...|:.....:.|.    ::.|         ||
plant   183 ETRCLRCETVTARD--ETFLDLSLDIEQNSSITSCLKNFSSTETLH----AEDKFFCDKCCSLQE 241

  Fly  1358 VVAWQQMTLEKLPVVLILHLKYFDY--RSDGCTKILKKVDFPVELKIDAKILGSKKTSQKQRAYR 1420
              |.::|.::|.|.:|::|||.|.|  :.....|:..:|.||:|||     |.:.........|.
plant   242 --AQKRMKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELK-----LSNTVEPYADVEYS 299

  Fly  1421 LFAVVYHDGKEASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHV------LQPHTPRVP--YLL 1477
            |||||.|.|...:.|||::.|  ..::.||.:||.:|:.:.|..|      .|.::....  |:|
plant   300 LFAVVVHVGSGPNHGHYVSLV--KSHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGYIL 362

  Fly  1478 YYRRSDTLPP 1487
            :|   ::|.|
plant   363 FY---ESLGP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 102/390 (26%)
Peptidase_C19 1223..1480 CDD:239072 76/278 (27%)
UBP3NP_568074.1 Peptidase_C19G 24..365 CDD:239128 103/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.