DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP36

DIOPT Version :10

Sequence 1:NP_728554.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001372098.1 Gene:USP36 / 57602 HGNCID:20062 Length:1124 Species:Homo sapiens


Alignment Length:80 Identity:14/80 - (17%)
Similarity:23/80 - (28%) Gaps:28/80 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LPQYREPGVLLWRGFTLEEFANQCFGNKADYGKGRQMPIHYGSNRLNYFTISSPIATQLPQAAGV 299
            |||...|...||                      .:.|:||      :..|:..:....|....|
Human   136 LPQAISPEGRLW----------------------SRPPLHY------FHLIALALRNSPPCGLSV 172

  Fly   300 GYSLKMDKKNACTVT 314
            .......::|.|.::
Human   173 QQIYSFTRQNICLLS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_728554.1 UCH 1110..1479 CDD:425685
USP36NP_001372098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..95
Peptidase_C19E 121..421 CDD:239126 14/80 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..577
PHA03247 <506..840 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.