DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and usp3

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001186800.1 Gene:usp3 / 569679 ZFINID:ZDB-GENE-030131-5142 Length:524 Species:Danio rerio


Alignment Length:395 Identity:103/395 - (26%)
Similarity:164/395 - (41%) Gaps:72/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1111 GLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLSEVKTPTVNAMMSFMTNFSSLPSGLRL 1175
            ||.|..|.|::|:|||:|.....|....:.:|..|....:.....:....|...:..||....|.
Zfish   164 GLRNLGNTCFMNAILQSLSNIQVFSCYFKELPSVALRSGKTAGRRMYHTRSQGDSSVSLVEEFRK 228

  Fly  1176 RLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEI-YKLWNDSREEHVEG-RQEDAEEFLGYVLNKL 1238
            .|.:|.:|||:               ||.|..: |.:|...  ....| :|:||.|||.|:|:.|
Zfish   229 TLCSLWQGSQT---------------AFSPDALFYVIWKIM--PSFRGYQQQDAHEFLRYLLDHL 276

  Fly  1239 NDEMLEVIKLIDKPTPQQNGQEPAEPED----------------GG----DVWQMICNNRNKGSV 1283
            :.||..  .....|:|.....||....:                ||    :|:.:||     |:.
Zfish   277 HREMQG--NKNGSPSPPVTSDEPNHASESKCFINGTSTIVTSVFGGVLQNEVYCLIC-----GTE 334

  Fly  1284 TRQTDFGRTPVSDI---FRGELRSRLQREGEHSTDVIQPFFTLQLNIEKAASVKEALEILVGRDQ 1345
            :|:.|    |..|:   ...:.|.:..::.|..     |..||...:.....::|.       |:
Zfish   335 SRKFD----PFLDLSLDIPNQFRIKTTKDQEPG-----PTCTLSDCLRSFTDLEEL-------DE 383

  Fly  1346 LEGVTGSKTKQEVVAWQQMTLEKLPVVLILHLKYFDYRSDGCTKILKKVDFPV-ELKIDAKILGS 1409
            .|.....|.|:...:.::..::|||.||.||||.|.:.:....|:...|:||: .|.:.:.:|..
Zfish   384 TELYMCHKCKKRQKSTKKFWIQKLPKVLCLHLKRFHWTAFLRNKVDTYVEFPMCGLDMKSYLLEP 448

  Fly  1410 KKTSQKQRAYRLFAVVYHDGKEASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVP 1474
            :.:..::..|.|.|||.|.|.....|||.....|.|  .|..::||:|..|||:.||:...    
Zfish   449 ENSLPERCLYDLAAVVVHHGSGIGSGHYTAYGRHEG--QWYHFNDSTVTLVSEEAVLKAKA---- 507

  Fly  1475 YLLYY 1479
            |:|:|
Zfish   508 YILFY 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 102/393 (26%)
Peptidase_C19 1223..1480 CDD:239072 75/281 (27%)
usp3NP_001186800.1 zf-UBP 29..109 CDD:280334
UCH 162..512 CDD:278850 102/393 (26%)
Peptidase_C19 164..513 CDD:271592 103/395 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.