DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP17L7

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001243798.1 Gene:USP17L7 / 392197 HGNCID:37180 Length:530 Species:Homo sapiens


Alignment Length:443 Identity:101/443 - (22%)
Similarity:152/443 - (34%) Gaps:130/443 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1086 EWTSKYAEYLTRHKTNLASISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSI-PKQAAVLS 1149
            :|...:...||..:.:.|...::...|:.:|.   ::|..:..| |.....:.|.: |::...||
Human    11 DWQFNHFSKLTSSRLDAAFAEIQRTSLSEKSP---LSSETRFDL-CDDLAPVARQLAPREKLPLS 71

  Fly  1150 EVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEIYKLWND 1214
            ..:...|.|                        |.|..|...:|...|||.....|...|.|   
Human    72 SRRPAAVGA------------------------GLQKIGNTFYVNVSLQCLTYTLPLSNYML--- 109

  Fly  1215 SREE---------------------------HV------------EGRQEDAEEFLGYVLNKLND 1240
            |||:                           ||            .|.||||.|||.:.::.:..
Human   110 SREDSQTCHLHKCCMFCTMQAHITWALHSPGHVIQPSQVLAAGFHRGEQEDAHEFLMFTVDAMKK 174

  Fly  1241 EMLEVIKLIDKPTPQQNGQEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSR 1305
            ..|...|.:|                          :.:|.:         |.:..||....||:
Human   175 ACLPGHKQLD--------------------------HHSKDT---------TLIHQIFGAYWRSQ 204

  Fly  1306 LQREGEHS-TDVIQPFFTLQLNIEKAASVKEALEILVGRDQLEGVTG---SKTKQEVVAWQQMTL 1366
            ::....|. :|...|:..:.|:|:.|.|||:|||.||...:|.|...   ....|:..|.:.:||
Human   205 IKYLHCHGVSDTFDPYLDIALDIQAAQSVKQALEQLVKPKELNGENAYHCGLCLQKAPASKTLTL 269

  Fly  1367 EKLPVVLILHLKYFDYRSDGC-TKILKKVDFPVELKIDAKILGSKKTSQKQR----AYRLFAVVY 1426
            .....||||.||.|   ||.. .|:.|.|.:|       |....:....:|.    .|.|:||:.
Human   270 PTSAKVLILVLKRF---SDVTGNKLAKNVQYP-------KCRDMQPYMSQQNTGPLVYVLYAVLV 324

  Fly  1427 HDGKEASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYY 1479
            |.|.....|||.:.| ......|.:.||:.|.......||....    |:|:|
Human   325 HAGWSCHNGHYFSYV-KAQEGQWYKMDDAEVTASGITSVLSQQA----YVLFY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 96/418 (23%)
Peptidase_C19 1223..1480 CDD:239072 70/266 (26%)
USP17L7NP_001243798.1 Peptidase_C19E 79..373 CDD:239126 87/371 (23%)
UCH 80..372 CDD:278850 86/368 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..412
HABP4_PAI-RBP1 <426..454 CDD:282609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..454
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.