DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP17L8

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001243801.1 Gene:USP17L8 / 392188 HGNCID:37181 Length:530 Species:Homo sapiens


Alignment Length:481 Identity:114/481 - (23%)
Similarity:165/481 - (34%) Gaps:157/481 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 SQLPAPVPAPTAPLVTPGALSYSAASAQ----AVPAPSPASASVKPLKPEPPRPVQQQLDEWTSK 1090
            |:|.:|.|              .||.|:    ::|..||.|:..:....:...||.:||      
Human    18 SKLTSPRP--------------DAAFAEIQRTSLPEKSPLSSETRVDLCDDLAPVARQL------ 62

  Fly  1091 YAEYLTRHKTNLASISLRP----RGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLSEV 1151
                ..|.|..|:  |.||    .||.|..|.||:|:.||.|....|..|.:         ||..
Human    63 ----APREKLPLS--SRRPAAVGAGLQNMGNTCYLNASLQCLTYTPPLANYM---------LSRE 112

  Fly  1152 KTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEIYKLWNDSR 1216
            .:.|.......|.                                  |.|     :.:..|....
Human   113 HSQTCQRPKCCML----------------------------------CTM-----QAHITWALHS 138

  Fly  1217 EEHV------------EGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQEPAEPEDGGD 1269
            ..||            .|:||||.|||.:.::.:....|...|.:|                   
Human   139 PGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGHKQVD------------------- 184

  Fly  1270 VWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREGEHS-TDVIQPFFTLQLNIEKAASV 1333
                   :.:|.:         |.:..||.|..||:::....|. :|...|:..:.|:|:.|.||
Human   185 -------HHSKDT---------TLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSV 233

  Fly  1334 KEALEILVGRDQLEGVTG---SKTKQEVVAWQQMTLEKLPVVLILHLKYFDYRSDGC----TKIL 1391
            |:|||.||..::|.|...   ....|...|...:||.....||||.||.|      |    .|:.
Human   234 KQALEQLVKPEELNGENAYPCGLCLQRAPASNTLTLHTSAKVLILVLKRF------CDVTGNKLA 292

  Fly  1392 KKVDFPVELKIDAKILGSKKTSQKQR---AYRLFAVVYHDGKEASKGHYITDVFHTGYSSWLRYD 1453
            |.|.:|..|.:...:      ||:..   .|.|:||:.|.|.....|:|.:.| ......|.:.|
Human   293 KNVQYPECLDMQPYM------SQQNTGPLVYVLYAVLVHAGWSCHNGYYFSYV-KAQEGQWYKMD 350

  Fly  1454 DSSVKPVSEKHVLQPHTPRVPYLLYY 1479
            |:.|...|...||....    |:|:|
Human   351 DAEVTACSITSVLSQQA----YVLFY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 93/396 (23%)
Peptidase_C19 1223..1480 CDD:239072 71/268 (26%)
USP17L8NP_001243801.1 Peptidase_C19E 79..373 CDD:239126 93/394 (24%)
UCH 80..372 CDD:278850 92/391 (24%)
HABP4_PAI-RBP1 375..454 CDD:282609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..412
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.