DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP27X

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens


Alignment Length:447 Identity:107/447 - (23%)
Similarity:166/447 - (37%) Gaps:124/447 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1097 RHKTNLASISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLSEVKTPTVNAMMS 1161
            |.:...:|.::..|||.|..|.|::|.|:|||.. :|   :||..........|:.:|.    :.
Human    65 RRRRITSSFTIGLRGLINLGNTCFMNCIVQALTH-TP---ILRDFFLSDRHRCEMPSPE----LC 121

  Fly  1162 FMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEIYKL----WNDSREEHVEG 1222
            .:...|||       ...|..|:.|                  |...|||    |..:|  |:.|
Human   122 LVCEMSSL-------FRELYSGNPS------------------PHVPYKLLHLVWIHAR--HLAG 159

  Fly  1223 -RQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQEPAEPEDGGDVWQMICNNRNKGSVTRQ 1286
             ||:||.|||...|                                 ||....|...:.|.....
Human   160 YRQQDAHEFLIAAL---------------------------------DVLHRHCKGDDVGKAANN 191

  Fly  1287 TDFGRTPVSDIFRGELRSRLQREGEHS-TDVIQPFFTLQLNIEKAAS----VKEALEILV-GRDQ 1345
            .:.....:..||.|.|:|.:..:..|. :..|.|.:.:.|::..:.:    :....|..| |...
Human   192 PNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESH 256

  Fly  1346 LEGVT---------------GSKTK---------QEVVAWQQMTLEKLPVVLILHLKYFDYRSDG 1386
            :.|:|               ||..|         ||  :.:|:|:.|||||...|.|.|::.:..
Human   257 IPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQE--STKQLTMNKLPVVACFHFKRFEHSAKQ 319

  Fly  1387 CTKILKKVDFPVELKIDAKILGSKK------------TSQKQRAYRLFAVVYHDGKEASKGHYIT 1439
            ..||...:.||:||.:...:..||:            :...:..|.|||||.|.|...| |||.:
Human   320 RRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNNENKYSLFAVVNHQGTLES-GHYTS 383

  Fly  1440 DVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYYRRSDTLPPQQQQTQQQN 1496
            .:.| ....|.:.||:.:...|.|.||...    .|||:|.: ..|..:.::.::.|
Human   384 FIRH-HKDQWFKCDDAVITKASIKDVLDSE----GYLLFYHK-QVLEHESEKVKEMN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 102/416 (25%)
Peptidase_C19 1223..1480 CDD:239072 72/298 (24%)
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 102/416 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.