DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and Usp5

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001246589.1 Gene:Usp5 / 38375 FlyBaseID:FBgn0035402 Length:827 Species:Drosophila melanogaster


Alignment Length:349 Identity:76/349 - (21%)
Similarity:129/349 - (36%) Gaps:79/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1080 VQQQLDEWTSKYAEYLTRHKTNLASISLRP--RGLTNRSNYCYINSILQALLGCSPFYNLLRSIP 1142
            :.|::.|||:     ||..::.|..:: .|  .|:.|..|.|||||::|.|.....|        
  Fly   306 INQRIGEWTA-----LTESESELQPVA-GPGYTGMRNLGNSCYINSVMQVLFVIPDF-------- 356

  Fly  1143 KQAAVLSEVKTPTVNAMMSFMTNFSSLPSG-LRLRLNNLNKGSQSKGKDDFVGSDLQCD--MAFE 1204
            :|..|.:..:        .:...|.|.|:. ..:::..|..|.||........:.|..|  ....
  Fly   357 QQRFVGTGAE--------RYFKEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHSTGIS 413

  Fly  1205 PTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQEPAEPEDG-- 1267
            |.....:...:..:....:|:||           ||..|.::.|:|:     |.:....|.|.  
  Fly   414 PAMFKNIVGKNHPDFSTKQQQDA-----------NDFYLHLLTLLDR-----NSRNQTNPADALK 462

  Fly  1268 ---GDVWQMICNNRNKGSVTRQTDFGRTPV--------SDIFRGELRSRLQRE-GEH--STDVIQ 1318
               .|..:.:.:::.|.:...:..| |.||        .::...:.|.:..|| |:.  ..|:::
  Fly   463 FLLEDRVECLASHKVKYNTREEYSF-RLPVPLDKATNLDEVREFQERKKAARETGQRLPDRDIVR 526

  Fly  1319 PFFTLQLNIEKAASVKEALEILVGRDQLE----GVTGSKTKQEVVAWQQMTLEKLPVVLILHLKY 1379
            ....||          ..||...|.:.:|    ...||||....:.    .|..:|..|::|:..
  Fly   527 HKVPLQ----------ACLERFFGPELIEQFYSTAIGSKTNARKIT----RLATMPDCLMIHVGK 577

  Fly  1380 FDYRSDGCTKILK-KVDFPVELKI 1402
            |....|...|.|. .||.|.||.:
  Fly   578 FTLGDDWVPKKLDVSVDMPDELDL 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 69/320 (22%)
Peptidase_C19 1223..1480 CDD:239072 45/201 (22%)
Usp5NP_001246589.1 UBP14 24..825 CDD:227532 76/349 (22%)
zf-UBP 204..278 CDD:280334
Peptidase_C19B 333..823 CDD:239123 68/316 (22%)
UBA1_UBP5_like 631..674 CDD:270480
UBA2_UBP5 696..737 CDD:270569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.