DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and Nelfa

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001008340.1 Gene:Nelfa / 305455 RGDID:1305556 Length:530 Species:Rattus norvegicus


Alignment Length:328 Identity:74/328 - (22%)
Similarity:110/328 - (33%) Gaps:106/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   805 PQVRNYGTMKMPSSPV----AWTAPTPERKNSQQAAAAPAAATASAAPVAITTVTTSTASI---- 861
            |.|:::...:.|.|..    .....|...:..:::|..|..|........:.| ||....|    
  Rat   158 PPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDT-TTPLKGIPKQA 221

  Fly   862 ----TATPNQFQPETGSSSASPAVAAAQQQQPA----------------AQQHAQAAQTGAAAAP 906
                ..||:.|.|....:...|:....|:::..                |::..:...|.....|
  Rat   222 PFRSPTTPSVFSPSGNRTPIPPSRTPLQKERGVKLLDISELNTVGAGREAKRRRKTLDTEVVEKP 286

  Fly   907 SKSHS-------NYA----SSKKHQSY--EPVVLSS-------VVATSSSANPQPQLNLAPPAPP 951
            :|..:       :||    |::|..|.  ||.:.|:       .|..:||..|..:   .|||||
  Rat   287 TKEETVVENATPDYAAGLVSTQKLGSLNSEPTLPSTSYLPSTPSVVPASSYIPSSE---TPPAPP 348

  Fly   952 ASQNSSDSSQLSWASLFASNKPVAKVAPYEASKIAQQQPSHPVLQLAPPQPAQVAAAAPVAQLSS 1016
            :.:              ||..|              ::||.|    :|..|.|....||:.....
  Rat   349 SRE--------------ASRPP--------------EEPSAP----SPTLPTQFKQRAPMYNSGL 381

  Fly  1017 PPQNLPLPTAHQQSQLPAPVPAPTA-PLVTPGALSYSAASAQAVPAPSPASASVKPLKPEPPRPV 1080
            .|.. |.|.|      ||....||| |.|||             .|.:|..|.|.| :.:.|.||
  Rat   382 SPAT-PTPAA------PASPLTPTAPPAVTP-------------TAQTPPVAMVAP-QTQAPAPV 425

  Fly  1081 QQQ 1083
            |||
  Rat   426 QQQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850
Peptidase_C19 1223..1480 CDD:239072
NelfaNP_001008340.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13328
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.