DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and T24B8.7

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_495931.4 Gene:T24B8.7 / 174440 WormBaseID:WBGene00011980 Length:2938 Species:Caenorhabditis elegans


Alignment Length:502 Identity:95/502 - (18%)
Similarity:163/502 - (32%) Gaps:210/502 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1082 QQLDEWTSKYAEYLTRHKTNLASISLRP---------RGLTNRSNYCYINSILQALL---GCSPF 1134
            |.|:.|    ::::...||  ...|.||         .|:.|....||:|:::|.|:   |.|..
 Worm  1788 QLLNMW----SKFMIAQKT--YDPSYRPIIRGRQFDKVGMKNDGGTCYMNAMIQQLVHVPGLSRE 1846

  Fly  1135 YNLLRSIPKQ-------AAVLSEVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDF 1192
            ...|::|..|       ||:|.|::  .|.|.::|....:.:|.|                    
 Worm  1847 LIALQNIDPQLRWGDNTAALLCELQ--RVFAQLNFAQCQAIVPEG-------------------- 1889

  Fly  1193 VGSDLQCDMAFEPTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQN 1257
                |..:..|||    .:..::::.|      ||.:|...:|:|.::    |:|.::.|...||
 Worm  1890 ----LWKEFRFEP----DMPLNTKQHH------DAIDFYSILLDKCDN----VLKKLELPPLFQN 1936

  Fly  1258 ---GQEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREGEHSTDVIQP 1319
               |:...|....|      |.:|.|                                |.|  :.
 Worm  1937 RFFGKYSYEKICYG------CWHRYK--------------------------------SPD--EE 1961

  Fly  1320 FFTLQLNIEKAASVKEALEILVGRDQLEGVTG---SKTKQEVVAWQQMTLEKLPVVLILHLKYFD 1381
            |..:.|.: ...:::||||..:....:||...   .|..::.....:.:..:||..:.:.||.|.
 Worm  1962 FNCISLAL-SGDNLEEALENFLAAHVMEGENAYHCEKCDEKKTTLNRTSFLELPSTMTIQLKRFT 2025

  Fly  1382 YRSDGCTKILKKVD----FPVELKI-------------------DAKILGS-------------- 1409
            |  |....:::|.:    ||.|:.:                   |..:.|:              
 Worm  2026 Y--DLVNNMIRKDNQLFRFPFEIDMTPYMTTSRHVPDEHVQDLFDEMLYGNGEADEAPSPPHKNG 2088

  Fly  1410 ---------------------KK-------------------------TSQKQRAYRLFAVVYHD 1428
                                 ||                         :.||...|.|..|:.|.
 Worm  2089 VAEKPNLGSGSASTPSLESAQKKMFRRHRSSTMRLSQSFANTSGFDTPSQQKPLIYELVGVLAHS 2153

  Fly  1429 GKEASKGHYIT----------DVFHTGYSSWLRYDDSSVKPVSEKHV 1465
            | .|:.|||.:          |..|  |:.|...:|..|.|:|..::
 Worm  2154 G-IATAGHYYSFIKERREEFRDSPH--YNKWHHINDMIVSPMSFNNI 2197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 88/475 (19%)
Peptidase_C19 1223..1480 CDD:239072 61/342 (18%)
T24B8.7NP_495931.4 UBA 133..168 CDD:197551
peptidase_C19C 1819..2234 CDD:239124 87/465 (19%)
UCH 1819..2229 CDD:278850 87/465 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D625455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.