DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and Usp9y

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_683745.2 Gene:Usp9y / 107868 MGIID:1313274 Length:2556 Species:Mus musculus


Alignment Length:544 Identity:116/544 - (21%)
Similarity:180/544 - (33%) Gaps:190/544 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 QAVP-APSPASAS-------------VKPLKP-----------EPPRPVQQQLDEWTSKYAEYLT 1096
            ||:| ..|||:.:             |:.||.           ..|....:.:.||     ||  
Mouse  1489 QAIPVCGSPATINAGFELLVALAFGCVRNLKQIVNCLTELFYIGTPVTTCEAVGEW-----EY-- 1546

  Fly  1097 RHKTNLASISLRPR----GLTNRSNYCYINSILQALLGCSPFYNLLRSI--------------PK 1143
                 |..:..||.    ||.|....||:||::|.|.......|.:.:|              .|
Mouse  1547 -----LPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNSILAIDSIWSDTDDDIFKGEK 1606

  Fly  1144 QAAVLSEVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQC---DMAFEP 1205
            |.   ||......:.:..:...|...|:        |:|....|..:..|...||.   .:|...
Mouse  1607 QD---SENNVDPRDDVFRYPHQFEDKPT--------LSKVEDRKEYNIAVLKHLQITFGHLAASQ 1660

  Fly  1206 TEIY---------KLWNDS---REEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNG 1258
            .:.|         :||.:.   ||:|      ||.||    .|.|.|.:.|..|.:..|      
Mouse  1661 LQYYVPKGFWQQFRLWGEPVNLREQH------DALEF----FNSLVDSLDEAFKALGYP------ 1709

  Fly  1259 QEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREG-EHSTDVIQPFFT 1322
                                             |.:|.:..|....:...:| .|..:..:.|.|
Mouse  1710 ---------------------------------TVLSKVLGGSFADQKICQGCPHRYECEESFTT 1741

  Fly  1323 LQLNIEKAASVKEALEILVGRDQLEGVTG---SKTKQEVVAWQQMTLEKLPVVLILHLKYFDY-- 1382
            |.::|....::.::||..|..|.|||...   .|..::|...:::.::|||.||.:.||.|||  
Mouse  1742 LNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPSVLTIQLKRFDYDW 1806

  Fly  1383 RSDGCTKILKKVDFPVELKID-------AKILGSKKTSQKQ---------------RAYRLFAVV 1425
            ..:...|.....:||.||.::       .|:.|.....|.|               ..|||..|:
Mouse  1807 ERECAIKFNDYFEFPRELDMEPYTVAGATKLEGDSVNPQTQLIKQNEQSESVIPGSTKYRLVGVL 1871

  Fly  1426 YHDGKEASKGHYITDVFH-----TGYSSWLRYDDSSVKPVSE--------------------KHV 1465
            .|.| :|:.|||.:.:..     :..|.|.::||..|.....                    .|:
Mouse  1872 VHSG-QANGGHYYSYIIQRNGKDSKRSHWFKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHM 1935

  Fly  1466 LQPHTPR------VPYLLYYRRSD 1483
            ::..:.|      ..|:|:|.|.|
Mouse  1936 MKRMSYRRQKRWWNAYILFYERMD 1959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 97/461 (21%)
Peptidase_C19 1223..1480 CDD:239072 66/315 (21%)
Usp9yNP_683745.2 peptidase_C19C 1557..1960 CDD:239124 99/464 (21%)
UCH 1559..1955 CDD:278850 96/456 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D625455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.