DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp10 and USP17L11

DIOPT Version :9

Sequence 1:NP_001261229.1 Gene:Usp10 / 38103 FlyBaseID:FBgn0052479 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001243783.1 Gene:USP17L11 / 100287178 HGNCID:44439 Length:530 Species:Homo sapiens


Alignment Length:474 Identity:113/474 - (23%)
Similarity:181/474 - (38%) Gaps:108/474 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1050 SYSAASAQAVPAPSPASASVKPLKPEPPRPVQQQLDEWTSKYAEYLTRHKTNLASISLRP----R 1110
            :::.....::|..||.|...:....:...||.:||          ..|.|..|:  |.||    .
Human    28 AFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQL----------APREKLPLS--SRRPAAVGA 80

  Fly  1111 GLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQAAVLSEVKTPTVNAMMSFMTNFSSLPSGLRL 1175
            ||.|..|.||:|:.||.|....|..|.:         ||...:.|.:.....|  ..::.:.:..
Human    81 GLQNMGNTCYVNASLQCLTYTPPLANYM---------LSREHSQTCHRHKGCM--LCTMQAHITR 134

  Fly  1176 RLNNLNKGSQSKGKDDFVGSDLQCDMAFEPTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLND 1240
            .|:|             .|..:|...|.           :...| .|:||||.|||.:.::.:..
Human   135 ALHN-------------PGHVIQPSQAL-----------AAGFH-RGKQEDAHEFLMFTVDAMKK 174

  Fly  1241 EMLEVIKLIDKPTPQQNGQEPAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSR 1305
            ..|...|.:|                          :.:|.:         |.:..||.|..||:
Human   175 ACLPGHKQVD--------------------------HHSKDT---------TLIHQIFGGYWRSQ 204

  Fly  1306 LQREGEHS-TDVIQPFFTLQLNIEKAASVKEALEILVGRDQLEGVTG---SKTKQEVVAWQQMTL 1366
            ::....|. :|...|:..:.|:|:.|.||::|||.||..::|.|...   ....|...|.:.:||
Human   205 IKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTL 269

  Fly  1367 EKLPVVLILHLKYFDYRSDGC-TKILKKVDFPVELKIDAKILGSKKTSQKQRAYRLFAVVYHDGK 1430
            .....||||.||.|   ||.. .||.|.|.:|..|.:...:   .:|:.....|.|:||:.|.|.
Human   270 HTSAKVLILVLKRF---SDVTGNKIAKNVQYPECLDMQPYM---SQTNTGPLVYVLYAVLVHAGW 328

  Fly  1431 EASKGHYITDVFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYY-RRSDTLPPQQQQTQQ 1494
            ....|||.:.| ......|.:.||:.|...|...||....    |:|:| ::|:    .::.::.
Human   329 SCHNGHYFSYV-KAQEGQWYKMDDAEVTASSITSVLSQQA----YVLFYIQKSE----WERHSES 384

  Fly  1495 QNGGGSGGVVGSSSSSSNA 1513
            .:.|.....:|:..:...|
Human   385 VSRGREPRALGAEDTDRRA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp10NP_001261229.1 UCH 1109..1479 CDD:278850 95/378 (25%)
Peptidase_C19 1223..1480 CDD:239072 72/262 (27%)
USP17L11NP_001243783.1 Peptidase_C19E 79..373 CDD:239126 94/375 (25%)
UCH 80..372 CDD:278850 94/373 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..413 3/22 (14%)
HABP4_PAI-RBP1 <426..454 CDD:282609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.