DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12502 and Tmem200b

DIOPT Version :9

Sequence 1:NP_001286893.1 Gene:CG12502 / 38102 FlyBaseID:FBgn0035171 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001188296.1 Gene:Tmem200b / 623230 MGIID:3646343 Length:284 Species:Mus musculus


Alignment Length:299 Identity:69/299 - (23%)
Similarity:104/299 - (34%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGGGTTK----RKHSLGNL--RRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGAG 64
            |.||..:    |...||..  ||..|.|..  ....||.::..:....|..|  ||..::|:|.|
Mouse     7 GDGGARRSPEGRVSRLGRRLGRRRRPRSPP--EPLRVRARLRLRSPSGAFAA--LGALVVLVGMG 67

  Fly    65 MATLGYY---ADHLSMGSELRGNVTVRVKNDLKGFHLNNFAYVGPIVMGFGGFIVVASCVMTFEA 126
            :|..||:   |.|.......|.:          |.| .....:||::||.|.|:.:.:..:.:|.
Mouse    68 IAVAGYWPGRASHTHAPRTGRAH----------GPH-ERLRLLGPVIMGVGLFVFICANTLLYEN 121

  Fly   127 RD-SAAKVVPARLRA-------GGGGSSKNPSRSNQGSSASQRRGMGAQYQSSRWD--------- 174
            || ...::....|||       |.|..:..||.:: ||.       ||..:...||         
Mouse   122 RDLETRRLRRGMLRAQALRPPDGPGWDALLPSPAH-GSP-------GAVAEPETWDLAPRRGPSP 178

  Fly   175 -QHFGVFRSSPGDPHQQPQTACISTTHPHQHSHPQQ------PFDREALTAEL----------VQ 222
             ......||.|.:|.        |......||:|.:      |:.....|..:          ::
Mouse   179 VPSVRSLRSEPANPR--------SGLPALLHSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIE 235

  Fly   223 FSRSL---------------SASNRFCPQWRRLSGAGSA 246
            .|:||               ..::|..|:..|||..|.|
Mouse   236 HSKSLDLGLGELLLGAPATRDCAHRSWPRLDRLSLGGYA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12502NP_001286893.1 DUF2371 <65..137 CDD:287186 17/75 (23%)
Tmem200bNP_001188296.1 DUF2371 <49..129 CDD:370858 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4823
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31815
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.