DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12502 and Tmem200a

DIOPT Version :9

Sequence 1:NP_001286893.1 Gene:CG12502 / 38102 FlyBaseID:FBgn0035171 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_006227752.1 Gene:Tmem200a / 498987 RGDID:1564024 Length:492 Species:Rattus norvegicus


Alignment Length:120 Identity:37/120 - (30%)
Similarity:58/120 - (48%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NVQVVRGKM---SSKCLWHACRALILGLTLMLLGAGMATLGYY--ADH-LSMGSELRGNVTVRVK 90
            :|.|||||:   |....:     ||||:.:.::|..||.|||:  .:| :...:.|..|.|..|:
  Rat    54 DVVVVRGKIRLYSPSGFF-----LILGVLVSIVGIAMAVLGYWPQKEHFIDAETTLSTNETQVVR 113

  Fly    91 ND----LKGF----HLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 137
            |.    ::.|    |.:....:||..||.|.||.:.:..:..|.||...|::..|
  Rat   114 NQGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12502NP_001286893.1 DUF2371 <65..137 CDD:287186 24/82 (29%)
Tmem200aXP_006227752.1 DUF2371 23..168 CDD:287186 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4823
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31815
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.