DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12502 and R05D7.3

DIOPT Version :9

Sequence 1:NP_001286893.1 Gene:CG12502 / 38102 FlyBaseID:FBgn0035171 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001368152.1 Gene:R05D7.3 / 173095 WormBaseID:WBGene00011028 Length:307 Species:Caenorhabditis elegans


Alignment Length:107 Identity:38/107 - (35%)
Similarity:62/107 - (57%) Gaps:14/107 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVRGKMSSKCLWHACRALILGLTLMLLGAGMATLGYYADHLSM------GSELRGNVTVRVKND- 92
            :::.|..:|.:|.||||:|.|..::.:|..|..|||:..|.|.      |||       :|..| 
 Worm    46 IIKKKADAKTVWAACRAVIFGCIIICVGLAMTVLGYFDKHFSEKVEIIDGSE-------KVSYDR 103

  Fly    93 LKGFHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVV 134
            :..:.|.:..|:|||:||.|.||::.:||:|.|:||..|:::
 Worm   104 MIQYQLKSMQYLGPILMGIGSFILIIACVVTLESRDKHAQII 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12502NP_001286893.1 DUF2371 <65..137 CDD:287186 28/77 (36%)
R05D7.3NP_001368152.1 DUF2371 <63..145 CDD:401985 31/88 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159426
Domainoid 1 1.000 77 1.000 Domainoid score I5804
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0017007
OrthoInspector 1 1.000 - - oto18423
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31815
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17084
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
77.020

Return to query results.
Submit another query.