DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12502 and tmem200b

DIOPT Version :9

Sequence 1:NP_001286893.1 Gene:CG12502 / 38102 FlyBaseID:FBgn0035171 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_005159619.1 Gene:tmem200b / 101885131 ZFINID:ZDB-GENE-060503-303 Length:403 Species:Danio rerio


Alignment Length:385 Identity:84/385 - (21%)
Similarity:129/385 - (33%) Gaps:128/385 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GTTKRKHSLGNLRR-----AHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGAGMATL 68
            |.|...||...|.|     .....|      |::||:..:.:..|  .|:||:.::::|..:|..
Zfish     8 GRTSATHSRQRLPRFSLHSRRKKEG------VIQGKLRIRSMPGA--FLVLGVVVVVVGTALAVA 64

  Fly    69 GY--YADHLS-----------------MGSELRGNVTVRVKNDLKGF-------HLNNFAYVGPI 107
            ||  |..|.|                 :||              ||.       |......:||:
Zfish    65 GYWPYRAHRSSLDTVEEGSSGTASGWGLGS--------------KGLFSAASLVHSERMKLLGPV 115

  Fly   108 VMGFGGFIVVASCVMTFEARDSAAKVVPARLRAG-GGGSSKNPSRSNQGSSASQRRGMGAQYQ-- 169
            :||.|.||::.:..:.:|.||...:::.|::|:. ...|:..||     :...|...:...||  
Zfish   116 IMGVGLFILICANTVLYENRDRETQMLLAQMRSVICSVSAAVPS-----ADLLQVNSLARHYQWV 175

  Fly   170 SSRWDQHFGVF------RSSP---------GDPHQQPQTACISTTHPHQHSHPQQPFDREALTAE 219
            ||....|..:.      .|.|         .|..||..|......| ||.|.          :..
Zfish   176 SSLPAAHLNILCLQEMSSSEPLLQVKSMDEEDSIQQQDTVHTEVLH-HQDSS----------STP 229

  Fly   220 LVQFSRSLSASNR-FCPQWRRLSGAGSAPDLSGSHAHANTTNSTNATNHQNPTTTVTTNYYNLLS 283
            .|..|.|.:.|.. .|...:|.:   ||.||. ..:|...:|...|:                 |
Zfish   230 SVHSSNSCNNSKEVLCMDEQRTT---SALDLR-QESHFALSNCMTAS-----------------S 273

  Fly   284 LNRLSPLDWELY-CSHRRHRRHHHR------------------HSHHHHHHHHKSSSSSV 324
            ::.|...:.|:: ...||....:||                  .|..||....:.|||.|
Zfish   274 MSTLGGEECEIFPIPPRRSYSMNHRTKPQILPRNLVHPEDKSVSSMGHHRLLPRQSSSEV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12502NP_001286893.1 DUF2371 <65..137 CDD:287186 21/97 (22%)
tmem200bXP_005159619.1 DUF2371 5..139 CDD:287186 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31815
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.