DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dpr21

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:236 Identity:91/236 - (38%)
Similarity:122/236 - (51%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GPHFEDVQRIGQAT-NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMH 327
            ||:|:.     .|| |:|...|.:.||||||..|.:|||||:||..          |.||||...
  Fly    50 GPYFDT-----SATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRD----------LHLLTVSES 99

  Fly   328 TYTGDKRYKMEF-QYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGD 391
            |||.|:|:...: :...:|.|:|...:..|..|||||:||.||....:...|..|   |...:|.
  Fly   100 TYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEP---ITSILGG 161

  Fly   392 PLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIA 456
            |  |.|.::.||:.|:||::::......|.|.|.:..:|||..||||||.|| ..|...|.|.|.
  Fly   162 P--EIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITE-KGDITTSYLLIQ 223

  Fly   457 KISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAV 497
            :.|..|||.|||..|...:.::.||||.|:      |..||
  Fly   224 RASIADSGQYTCLPSNANSKSVNVHILKGD------HPAAV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 43/105 (41%)
IG_like 278..365 CDD:214653 36/87 (41%)
Ig strand B 287..291 CDD:409382 2/3 (67%)
Ig strand C 300..304 CDD:409382 3/3 (100%)
Ig strand E 345..349 CDD:409382 2/3 (67%)
Ig strand F 359..364 CDD:409382 4/4 (100%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 31/77 (40%)
Ig strand B 404..408 CDD:409353 1/3 (33%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 2/3 (67%)
dpr21NP_001163838.2 Ig 71..149 CDD:472250 36/87 (41%)
Ig strand C 82..86 CDD:409353 3/3 (100%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 4/4 (100%)
Ig 169..249 CDD:472250 32/80 (40%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 2/3 (67%)
Ig strand F 232..237 CDD:409353 3/4 (75%)
Ig strand G 246..249 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.