DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and KIRREL2

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:213 Identity:54/213 - (25%)
Similarity:78/213 - (36%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTY 329
            |||     :.|..:|.|..|....|.|.:..... .|.|.:         :|.||.    |....
Human    24 PHF-----LQQPEDLVVLLGEEARLPCALGAYWG-LVQWTK---------SGLALG----GQRDL 69

  Fly   330 TGDKRYKMEFQYPNNWR-LKITNVKKDDEAIYECQISTHPPRVIQINLHV----NAPKVMIVDEV 389
            .|..||.:.....|... |.|..|:.:|||.||||.:....|.....|||    .||:|:     
Human    70 PGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVL----- 129

  Fly   390 GDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDG----AN 450
            |.|.......:.:  .|:|..|..|..:..:.| ..|.:|     ..|.:....|:::|    ..
Human   130 GGPSVSLVAGVPA--NLTCRSRGDARPTPELLW-FRDGVL-----LDGATFHQTLLKEGTPGSVE 186

  Fly   451 STLSIAKISKTDSGNYTC 468
            |||::...|..|...:.|
Human   187 STLTLTPFSHDDGATFVC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 25/87 (29%)
Ig 279..378 CDD:299845 27/99 (27%)
Ig 400..471 CDD:299845 16/73 (22%)
IG_like 402..480 CDD:214653 16/71 (23%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 27/102 (26%)
IGc2 38..106 CDD:197706 23/81 (28%)
I-set 126..224 CDD:254352 20/92 (22%)
Ig2_KIRREL3-like 141..223 CDD:143236 16/72 (22%)
Cell attachment site. /evidence=ECO:0000255 149..151 1/1 (100%)
Ig 231..306 CDD:299845
IG_like 234..308 CDD:214653
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.