DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and nectin4b

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_001334985.6 Gene:nectin4b / 794920 ZFINID:ZDB-GENE-070912-114 Length:570 Species:Danio rerio


Alignment Length:347 Identity:60/347 - (17%)
Similarity:100/347 - (28%) Gaps:160/347 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 AGSSIHLNCRISLLQDKT---VSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKME------ 338
            :||...|.|.....:|.|   |:|.||...      |....::|   ..||...:...|      
Zfish    33 SGSEARLKCVFVAPRDVTVVQVTWSRHTPA------GKTQQIIT---GHYTEGPKVSPEFADGFR 88

  Fly   339 FQYPN---NWRLKITNVKKDDEAIYECQIST---------------------------------- 366
            |:.|:   :..|.|.|..:.||.:|.|.|:|                                  
Zfish    89 FESPDPLTDSTLLIENTVRADEGVYTCSIATFPSGNFQRRISLSVWMYPISSVEHVVLKEGQSYG 153

  Fly   367 ---------HPPR----------------------VIQINLH----VNAPKVMIVDEVGDPLQEK 396
                     |||.                      ..|.:|:    :|..|:..:  |..|:.|:
Zfish   154 IAASCRAVAHPPARLSWDTDVSGQSQNRSGDGGVVTTQFSLYPSRSMNGQKLDCL--VWHPVYEE 216

  Fly   397 YYEIDSTL-----------------------QLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGV 438
            .:.:.:.|                       ::.|:|:...:..: |.|...|.:|     ..||
Zfish   217 PHRLANKLVVQFPPDAEAVGSGSWQIGSSGSEIRCLVKGNPLPQN-VSWSRSDGVL-----PSGV 275

  Fly   439 SVKTELMEDGANSTLSIAKISKTDSGNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTW 503
            .|:.:.:       :....:.:||.|.|.|.          .|...|.:.||.            
Zfish   276 LVQKDRL-------VFSRPLQQTDEGVYVCR----------THNTLGVAKAEF------------ 311

  Fly   504 WNMVMLHAMALLVLNSLRGEFS 525
                      .|.::::|.|||
Zfish   312 ----------TLQIDAVRSEFS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 26/139 (19%)
IG_like 278..365 CDD:214653 24/93 (26%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 2/6 (33%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 15/100 (15%)
Ig strand B 404..408 CDD:409353 1/26 (4%)
Ig strand C 417..423 CDD:409353 1/5 (20%)
Ig strand E 451..455 CDD:409353 0/3 (0%)
nectin4bXP_001334985.6 Ig 34..134 CDD:472250 26/108 (24%)
Ig strand B 37..41 CDD:409471 1/3 (33%)
Ig strand C 53..57 CDD:409471 1/3 (33%)
Ig strand E 98..102 CDD:409471 1/3 (33%)
Ig strand F 112..117 CDD:409471 2/4 (50%)
Ig strand G 126..129 CDD:409471 0/2 (0%)
Ig 146..226 CDD:472250 11/81 (14%)
Ig strand B 154..158 CDD:409501 0/3 (0%)
Ig strand C 167..171 CDD:409501 0/3 (0%)
Ig strand E 190..194 CDD:409501 1/3 (33%)
Ig strand F 204..209 CDD:409501 1/6 (17%)
Ig strand G 219..222 CDD:409501 0/2 (0%)
Ig 248..315 CDD:472250 19/111 (17%)
Ig strand B 248..251 CDD:409390 0/2 (0%)
Ig strand C 261..265 CDD:409390 1/4 (25%)
Ig strand E 281..285 CDD:409390 0/10 (0%)
Ig strand F 295..300 CDD:409390 2/14 (14%)
Ig strand G 308..311 CDD:409390 1/2 (50%)

Return to query results.
Submit another query.