DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and nectin3a

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_073779583.1 Gene:nectin3a / 793240 ZFINID:ZDB-GENE-130530-670 Length:644 Species:Danio rerio


Alignment Length:334 Identity:64/334 - (19%)
Similarity:108/334 - (32%) Gaps:123/334 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTV---S 302
            |:|.::|....            |.....|....|.|::   .|.::.|:||:.:..:.::   |
Zfish    20 PLLGFLFSACD------------GVWSNQVVVPAQVTSV---LGKNVTLSCRMEMSSNLSLTQSS 69

  Fly   303 WVRHNTQDEGKDNGNALDLLTVGMH-----TYTGDK-RYKMEFQYP--NNWRLKITNVKKDDEAI 359
            |.||...          .::|:.:.     |...|: ..::.|..|  ::..:.:..|...|..:
Zfish    70 WERHLPS----------GIITLAVFNPVYGTSVADEYSRRVHFLKPSVHDVSIVLQGVGFADIGM 124

  Fly   360 YECQISTHPPRVIQINLHVNA---PKVMI-------------------VDEVGDPLQEKYYEID- 401
            |.|::.|.....:|.:.:|:.   |||.:                   ..|.|.|..|.::|.| 
Zfish   125 YTCKMVTFELGNMQASTNVDVMVEPKVYVSPGSLSLTADDGETLVATCTAERGRPAAEVFWESDL 189

  Fly   402 ----------------STL--------------QLSCVVRNVAMTSSVVFWKHMDNILNYDV-TR 435
                            :||              .||||||:.|::........::.....|| ..
Zfish   190 PGQTAVVTQSEPEGTTTTLVHYVLAPTRASHGRSLSCVVRHPALSRDFRIPYRLNVFFVPDVMVI 254

  Fly   436 GGVSV---------------------------KTELMEDGAN----STLSIAKISKTDSGNYTCS 469
            ||.:|                           ...||..|.|    |.:....:..||||.|.|.
Zfish   255 GGKNVWYVGQKDVQLDCKANANPPALFYLWTRLDALMPAGVNMHNGSLVFTRPLEATDSGQYRCE 319

  Fly   470 ISE--FQNF 476
            :..  .|||
Zfish   320 VQNDVGQNF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 25/137 (18%)
IG_like 278..365 CDD:214653 17/97 (18%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 1/6 (17%)
Ig strand E 345..349 CDD:409382 0/3 (0%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 28/123 (23%)
Ig strand B 404..408 CDD:409353 2/17 (12%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
nectin3aXP_073779583.1 None

Return to query results.
Submit another query.