DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and Negr1

DIOPT Version :10

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_063138498.1 Gene:Negr1 / 59318 RGDID:708416 Length:423 Species:Rattus norvegicus


Alignment Length:223 Identity:48/223 - (21%)
Similarity:84/223 - (37%) Gaps:56/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 NLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNG---NALDLLTVGMHTYTGDKRYKMEF 339
            |:.|:.|.:..|.|.:                ::|...|   |...::..|...::.|.|..:..
  Rat    41 NMLVRKGDTAVLRCYL----------------EDGASKGAWLNRSSIIFAGGDKWSVDPRVSIST 89

  Fly   340 QYPNNWRLKITNVKKDDEAIYECQIST-HPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDST 403
            ....::.|:|.||...|:..|.|.:.| |.||.:|::|.|..|             .|.|:|.:.
  Rat    90 LNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVP-------------PKIYDISND 141

  Fly   404 LQLSCVVRNVAMT-------SSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKT 461
            :.:: ...||.:|       ...:.|:|             :|...:..|:|  ..|.|..|::.
  Rat   142 MTIN-EGTNVTLTCLATGKPEPAISWRH-------------ISPSAKPFENG--QYLDIYGITRD 190

  Fly   462 DSGNYTCSISEFQNFTIVVHILNGESFA 489
            .:|.|.||.....:|..|..:....:||
  Rat   191 QAGEYECSAENDVSFPDVKKVRVVVNFA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 PHA02785 101..368 CDD:165149 19/93 (20%)
IG_like 278..365 CDD:214653 18/89 (20%)
Ig strand B 287..291 CDD:409382 1/3 (33%)
Ig strand C 300..304 CDD:409382 0/3 (0%)
Ig strand E 345..349 CDD:409382 1/3 (33%)
Ig strand F 359..364 CDD:409382 2/4 (50%)
Ig strand G 371..374 CDD:409382 0/2 (0%)
IG_like 402..480 CDD:214653 16/84 (19%)
Ig strand B 404..408 CDD:409353 0/3 (0%)
Ig strand C 417..423 CDD:409353 0/5 (0%)
Ig strand E 451..455 CDD:409353 1/3 (33%)
Negr1XP_063138498.1 None

Return to query results.
Submit another query.