DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and CG34353

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:372 Identity:73/372 - (19%)
Similarity:114/372 - (30%) Gaps:135/372 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 PARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGP--------- 265
            |.|:.|      |:.::..|.......|.::.......:..:.:...|..|:|.|.         
  Fly     7 PTRSSS------SSSRIAYKFECHSNSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPHILFLAI 65

  Fly   266 -----HFEDVQR-----------IGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKD 314
                 |||.|..           |.::.......|.:|.|.|.::......|:|.|         
  Fly    66 AVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR--------- 121

  Fly   315 NGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVN 379
               .:.:||.|....|.|.|.::    .|.:.|:|.:....|...|.|||:|..||.|...:.:.
  Fly   122 ---GIAILTAGSVKVTPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEIL 179

  Fly   380 APKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNIL--------------- 429
            .|..:.....|..||.|.   .|::::.|......|.:  |.|...:|||               
  Fly   180 VPPRIHHISTGGHLQVKK---GSSVRIECSATGNPMPN--VTWSRKNNILPNGEEKLHSHVLSIE 239

  Fly   430 NYDVTRGGVSVKT---------------------------------------------------- 442
            |.|..:|||.:.|                                                    
  Fly   240 NVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEV 304

  Fly   443 --------------ELMED-GANSTLSIAKISKTDSGNYTCSISEFQ 474
                          .:||. |:..||.|.|:...|.|||:| ::|.|
  Fly   305 IWFKDTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSC-VAENQ 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 20/86 (23%)
Ig 279..378 CDD:299845 25/98 (26%)
Ig 400..471 CDD:299845 26/152 (17%)
IG_like 402..480 CDD:214653 28/155 (18%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/95 (26%)
Ig 103..177 CDD:143165 24/89 (27%)
IG_like 191..269 CDD:214653 17/82 (21%)
IGc2 198..258 CDD:197706 14/61 (23%)
I-set 273..360 CDD:254352 14/79 (18%)
Ig 290..359 CDD:143165 14/62 (23%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.