DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and dscama

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:531 Identity:102/531 - (19%)
Similarity:178/531 - (33%) Gaps:155/531 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PAARTRPRTKSTTDATKFSSSRGDLHLDCAVPNLIRLLLLIATIMGSGLVQAKTIYDSVNMIQSL 70
            |..|.....:.....::|..|...|.::.|.|          :..||.:.:....|.:..:|..|
Zfish   255 PKYRWLKNNRPLESDSRFRQSVTGLLIERAQP----------SDTGSYVCEVWNSYGNAEVIGRL 309

  Fly    71 DALVEPRETTKVPLQTTPATPPTAHAHIHNQVSTLRSSYEDSDD--------------------- 114
                    |.|.||:.. .:|......:.:||| |..|...||:                     
Zfish   310 --------TVKEPLKAV-VSPRKVKGSVGSQVS-LSCSVTGSDEFELSWYRNGDKINTGANIRMN 364

  Fly   115 GVDGDYVI----PESQTSTVAILDQDSSMKGQDMESLSLQAGSGTVSPKSSPDSSGHKKNASFQQ 175
            |::.:.::    .:|.........:.:.|..||...:.|:.|:..:....|....|         
Zfish   365 GINKENLVMDGMAKSDGGVYQCFSRKAKMSAQDFVQVILEDGTPKILSAFSEKVVG--------- 420

  Fly   176 IGSQNVNALVPATVATTSSGLPSSSNASLATPTEPARNRSTGLVRNSAVKVDSKHPLSKGQKTDA 240
                 .|..|..|...  .|.|           :||   .|..:.:..|..||:|.:......:.
Zfish   421 -----PNDFVSLTCHV--KGTP-----------QPA---ITWTLDDEVVAKDSRHRIVHSITAEG 464

  Fly   241 PMLNYIFDTFSSANKHHHHDQRYGPHFEDVQR-----------------------IGQATNLTVQ 282
            .:::|:       |..|...:..|     |.|                       |....|||..
Zfish   465 NVVSYL-------NISHIQVRDSG-----VYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAI 517

  Fly   283 AGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRL 347
            ||..::::|.:......::.|.:         |.|.|..         .|::...|    ||..|
Zfish   518 AGWDMYIHCHVIGYPYYSIKWFK---------NSNLLPF---------NDRQRAFE----NNGTL 560

  Fly   348 KITNVKKD-DEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVR 411
            |:.||:|: ||..|.|.:...|......::||...    |.....|.:...|.|...:.:.||||
Zfish   561 KLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVK----VPPFIQPFEFPRYSIGHRVFVPCVVR 621

  Fly   412 NVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGAN--STLSIAKISKTDSGNYTC------ 468
            :..:..|:. |:.....:|..:   ||::      |..:  |:|.|:.:.:..:|.|||      
Zfish   622 SGDLPISIT-WEKDGKSINASL---GVTI------DNIDFTSSLRISNLQRVHNGTYTCIAQNDA 676

  Fly   469 SISEFQNFTIV 479
            ::.::|:..||
Zfish   677 AVVKYQSQLIV 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 23/87 (26%)
Ig 279..378 CDD:299845 23/99 (23%)
Ig 400..471 CDD:299845 18/78 (23%)
IG_like 402..480 CDD:214653 20/86 (23%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352 12/73 (16%)
IG_like 321..402 CDD:214653 13/81 (16%)
I-set 408..502 CDD:333254 20/135 (15%)
IGc2 524..579 CDD:197706 18/76 (24%)
Ig 614..679 CDD:319273 17/74 (23%)
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.