DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and igsf9ba

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:240 Identity:49/240 - (20%)
Similarity:85/240 - (35%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 MLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRH 306
            ||...:|||.:.: ..|......|.|.|.    ....:..:.|.||.|.|.........|:|:|.
Zfish   117 MLEQQYDTFHNGS-WVHLTVNAPPTFSDT----PPQYVEAREGGSITLTCTAFGNPKPVVTWLRE 176

  Fly   307 NTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQI------S 365
            ..|                   .|..::|.:     ::..|.:..:.::|...|.|:.      :
Zfish   177 GDQ-------------------LTSTRKYTV-----SDGSLTVQAITREDRGAYSCRAHSDQGEA 217

  Fly   366 THPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVR----NVAMTSSVVFWKHMD 426
            .|..|::     |..|..::.     |.:.....|....|.:|...    |:..|   .:|:. |
Zfish   218 LHTTRLL-----VQGPPYIVT-----PPENITVNISQNAQFTCQAEAYPGNLTYT---WYWEE-D 268

  Fly   427 NILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSIS 471
            |:    ..:..:.::..:..||   ||.|.::...|:|.||||.|
Zfish   269 NV----YFKNDLKLRVRIFIDG---TLIIYRVKPEDAGKYTCSPS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 15/92 (16%)
Ig 279..378 CDD:299845 17/104 (16%)
Ig 400..471 CDD:299845 19/74 (26%)
IG_like 402..480 CDD:214653 19/74 (26%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352 20/118 (17%)
I-set 229..321 CDD:333254 21/94 (22%)
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.