DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and robo4

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:412 Identity:80/412 - (19%)
Similarity:144/412 - (34%) Gaps:122/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ATPP--------TAHAHIHNQVSTLRSSYEDSDDGVDGDYVIPESQTSTVAILDQDSSMKGQDME 145
            |.||        ....|:.:::...|:|:.|......|..::.|.....:.....|..::.....
Zfish    24 ACPPDEQVAQRSEGKGHLRHRLMHQRASHRDRAHRRKGSRLVSEINLPRIVHHPSDVVVRVGSPA 88

  Fly   146 SLSLQAGSGTVSP-----KSSPDSSGHKKNASFQQI----GSQNVNALVP-----------ATVA 190
            :||.:| .|...|     ::.......|.:|..|.|    ||....::||           |.:|
Zfish    89 TLSCRA-EGNPEPTIQWLRNGQPLDTDKMDAQSQPIVLPDGSLFFFSVVPGRKGQSHEAVYACIA 152

  Fly   191 TTSSGLPSSSNASL----------ATPTE-------------------PARN---RSTGLVRNSA 223
            ..|.|..:|.||||          ..|::                   |..|   |..|::.||:
Zfish   153 HNSIGNATSRNASLHIAALREDFRVQPSDVEVAIGEMATINCSPPVGHPEPNVTWRKDGILINSS 217

  Fly   224 ----VKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDVQRIG---------Q 275
                .::..|..::..||.|:.:.:.|     ::|.....:.|       ..|:.         :
Zfish   218 NEHYTELKGKLIIAPAQKNDSGVYSCI-----ASNMIGVRESR-------AARLSVLAKPVLLRK 270

  Fly   276 ATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGK-DNGNALDLLTVGMHTYTGDKRYKMEF 339
            ..:::||.|.|....|........::.|.|    ::|. .||                 ||.:. 
Zfish   271 PEDVSVQLGESAQFFCEADGDPMPSIEWSR----EQGPLPNG-----------------RYLIN- 313

  Fly   340 QYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTL 404
              |:: .|:|..|...|...|.|.:..      ::.:.|.:.::::.|..|..|::.:.|: |.|
Zfish   314 --PDH-SLQIHYVTAQDMGRYSCTVEN------KLGVSVASAQLLVEDAGGTRLRDLHKEL-SAL 368

  Fly   405 QLS---CVVRNVAMTSSVVFWK 423
            ::|   ..|.:.|...|.|.||
Zfish   369 RVSLENVTVMSTASNMSQVMWK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653 19/87 (22%)
Ig 279..378 CDD:299845 19/99 (19%)
Ig 400..471 CDD:299845 9/27 (33%)
IG_like 402..480 CDD:214653 9/25 (36%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 23/99 (23%)
I-set 71..168 CDD:254352 23/97 (24%)
I-set 175..261 CDD:254352 15/97 (15%)
Ig2_Robo 177..261 CDD:143201 15/95 (16%)
I-set 265..350 CDD:254352 20/115 (17%)
Ig 282..350 CDD:299845 16/98 (16%)
FN3 373..448 CDD:214495 6/18 (33%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.