DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr20 and lrit3a

DIOPT Version :9

Sequence 1:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:183 Identity:45/183 - (24%)
Similarity:72/183 - (39%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YDSVNMIQSLDAL-VEPRETTKVPLQTTPATPPTAHAHI-HNQVSTLRSSYEDSDDGVDGDYVIP 123
            ::|:..:.||..| :.....|.||::..|......:..| .|:::||.|...|......|  :.|
Zfish   122 WESLKEMPSLKTLDLHNNRLTSVPVEAAPYLINITYLDISSNKLTTLPSDLVDIWPPFSG--IQP 184

  Fly   124 ESQTSTVAILD-QDS----SMKGQDMESLSLQAGSGTVSPKSSPDSSG--HKKNASFQQIGSQNV 181
            .:.||...:|. ||:    ..:...:..||..||...|........||  |.....||:   ..:
Zfish   185 SANTSQKTVLGLQDNPWYCDCRISKLIELSKMAGIPVVLMDQVLTCSGPEHLSGVLFQR---AEL 246

  Fly   182 NALVPATVATTSSGL--PSSSNASL-------ATPTEPARNRSTGLVRNSAVK 225
            :..|..||.|:::.:  |..||..|       .|||.........:|.|:.|:
Zfish   247 DQCVKPTVMTSATKITSPLGSNVLLRCDANGFPTPTLLWTTADGSVVNNTVVQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr20NP_612066.1 IG_like 278..365 CDD:214653
Ig 279..378 CDD:299845
Ig 400..471 CDD:299845
IG_like 402..480 CDD:214653
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566 4/18 (22%)
leucine-rich repeat 83..106 CDD:275378
LRR_4 107..145 CDD:289563 5/22 (23%)
leucine-rich repeat 107..130 CDD:275378 1/7 (14%)
LRR_8 129..>171 CDD:290566 11/41 (27%)
LRR_4 129..170 CDD:289563 11/40 (28%)
leucine-rich repeat 131..154 CDD:275378 6/22 (27%)
leucine-rich repeat 155..168 CDD:275378 2/12 (17%)
TPKR_C2 199..249 CDD:301599 10/52 (19%)
Ig 252..343 CDD:299845 13/48 (27%)
IG_like 261..343 CDD:214653 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.